The GMOD/SFM Splatoon / “SplatSource” Community - A cross between the Splatoon and Garry's Mod / SFM communities, with extreme autism involved

Tread Miller

Custom title:
True & Honest Fan
kiwifarms.net
Joined
Jul 5, 2022
Link to original thread
The GMOD/SFM Splatoon / “SplatSource” Community
splatoon gmod logo.webpsplatoon sfm logo.webpsplatsource logo.webp
REMEMBER: ARCHIVE EVERYTHING! People in this community tend to DELETE EVERYTHING when things go wrong! Even if it’s been up for years and likely abandoned and forgotten, better safe than sorry!

INTRODUCTION
The original OP was quite frankly very bad, and barely covered two of the most insane events in this community, so I wanted to fix that and add more. The drama about this community is very interesting but it is scattered around the Internet, with some of the coverage being incorrect, taken out of context, or interpreted wrongly. In some existing threads (including the original thread) I’ve already written about this community, so I wanted to have a thread to put it all in one place and fix any mistakes I made in the original posts.
The GMOD/SFM Splatoon community, also known as the “SplatSource” community, is a community that is made up of fans of Splatoon and Garry’s Mod (GMOD) / Source Filmmaker (SFM). If you do not know what any of these three are:
Splatoon is a Japanese third-person shooter published by Nintendo, targeted towards kids and teens. It features the squid-kid combination of Inklings. Starting in the sequel, Splatoon 2 (via its DLC, Octo Expansion), Octolings (octopus-kid combination) were made playable.
Inkling girlOctoling boy and girl
Each game has a thread, but they all seem to be focused on the game and not drama around the community.
General Splatoon thread
Splatoon 2 thread
Splatoon 3 thread

Garry’s Mod (GMOD) is a digital “physics sandbox,” created by Garry Newman, which allows for user-created content to be used. Relevant to this thread, Splatoon-related add-ons are uploaded to the Steam Workshop and other websites, which many in this community use. It has a thread here.
Garry’s Mod thread

Source Filmmaker (SFM) is a movie making program that lets the user make animations in the Source engine, released by Valve. Like Garry’s Mod, people have uploaded Splatoon-related content to SFM’s Steam Workshop for others to use in their work.

Before starting, I should note that (perhaps unsurprisingly) a lot of people in this community have autism. Here’s a sample of some people admitting to having or noticing a lot of autism in SplatSource:
Ellie Godelia:

DjSwaggy:
I honestly do think Ellie h-h- does have some social- some sort- socialization issue-

Pineapple:
She admitted to that.

Delta225:
She admitted (DjSwaggy: Yeah!) to that.

DjSwaggy:
That part, that-

Pineapple:
She also told me she’s autistic, so…
(A Conversation With Ellie Godelia, 1:44:15)

CuteYoshiLover (A):


RudyOctolingVA and TehCandianSpartan:
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Chatlogs [SOME MAY CONTAIN NSFW]\Direct Messages - Rudy [559816718059569164].html)

Jacktropolis:
(Jacktropolis Google Drive\Perverted Stuff\Lori\Full Chatlogs\Direct_Messages_-_QueenLoriVA_587870122279043073_1_1-1.html)

I’m not the only one that has observed a lot of autistic people in this community, as some others have also gleaned this:
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Chatlogs [SOME MAY CONTAIN NSFW]\Direct Messages - Broadside, Noctis Axton Aurora, TrueLegendary, JackInkling, JaXson [642440737874771983].html)

While this DeviantArt post (A) is more Gacha Life, the poster and most of the people mentioned in the post’s description are also part of the SplatSource community.

Using Garry’s Mod or Source Filmmaker (both are on the Source engine, hence the “Source” in SplatSource), people in this community make art / animations. Since the Inklings/Octolings are very customizable, making OCs is a very common activity. As you may expect from the above, it predictably gets a little silly.
Meet Rai and LeesiHaving Pepperoni PizzaKittyKoopaTK's OCsTo the BoneMatilda's new giant friendMiles Spletzer meeting Obama
Meet Rai and Leesi (Splatoon Gmod Poster)/A
Having Pepperoni Pizza [Splatoon SFM Art Trade]/A
KittyKoopaTK's OCs/A
To the Bone (Undertale)/A
Matilda’s giant new friend (Danganronpa)/A
Miles Spletzer meeting Obama (SMG4)/A

The silliness doesn’t stop at BeeWinter55’s deviation. Bonus points for the last one being a Splatoon GMOD post made to pay tribute to the Charlie Hebdo shooting and talk about the “barbarian islamic” :story:
Playdate with LexieGlorious PortraitsReading The BibleNous resterons la France de CharlieNous resterons la France de Charlie description
Playdate with Lexie/A
[SFM/Splatoon] Glorious Portraits/A
Reading The Bible As Brothers/A
Nous resterons la France de Charlie/A

Also unsurprisingly, despite Splatoon fanbase trending younger, there are some that make suggestive/NSFW content in SplatSource.
Shanequa 1Shanequa description
Shanequa 2Shanequa 3Shanequa 4
As you can probably expect, she is supposed to be “African-American” and unemployed.
splatoon character bio: Shanequa/A

Gentle Giant's Kiss
Gentle Giant's Kiss/A

These next two don’t require an account; anyone can see them. Coincidentally, both of these DeviantArt accounts are French.
New look and sexy :3Happy Birthday Mushiking !
New look and sexy :3/A
Happy Birthday Mushiking !/A

As fun as it is to simply watch these groups, a community like this is also bound to have some drama. In fact, if you have prior knowledge of this community, then some of the names above may be familiar. Along with some of the silly stuff shown above, this thread is meant to document the horrifying and funny stories/drama that gave this Splatoon subcommunity the horrible reputation it has.
Table of Contents
The Beginning - How SplatSource (and its community) came to be
Heavy The Squid - First major controversy of the community, one of the biggest YouTubers at the time who was 24 ERPed with a then 15-year-old
Ellie Godelia - Heavy’s grooming victim became an attention whore and faked her suicide in front of her friends, being saved by a cat
Brian Jackson II - Guy who had anger issues and couldn’t handle criticism, after being blamed for making someone suicidal fakes his suicide
Geofcraze634 - Caught trying to jerk off to feet pics from a 14-year-old and the 17-year-old Ellie Godelia (who didn’t expose him even though this took place after Heavy’s drama)
TehCanadianSpartan & Peachy - Trolling plan accidentally reveals how gross TehCanadianSpartan is as both an e-boyfriend and how he talks to teenagers; Ellie also gets involved
Jacktropolis - Alien vs. Predator; commie that had beef with TCS was exposed for not only cheating on his long-distance girlfriend, but doing so by ERPing with his 14-year-old ex on Discord who was dating his closest Discord admin
Lewd House - ERP Discord server with some of the biggest creators and also minors, and the fallout from that
Post Lewd House - The Lewd House gets reinvestigated and Ellie Godelia fakes her suicide again, other interesting stories after Lewd House chronologically
Aaron Peters - Caused many Nintendo-related (including Splatoon) GMOD/SFM addons to get removed, people left due to difficulty in finding addons
Associated Figures - Various people/groups who have interacted with those in the SplatSource community
Conclusion - A note about how the OP has changed, and some final thoughts
Any embeds inside should have a source (whether in the alt text or underneath) if you're curious as to where I got them from.

The Beginning​
(Alex Spider's Splanimations Archives article)(SMG4: If Mario Was In... Splatoon, 0:07)

SplatSource is considered to have started with Alex Spider (who was previously a Team Fortress 2 GMOD animator) when he released a video “Daily Squid Sisters,” being deemed the first SplatSource video ever.

Alex Spider was not alone in SplatSource, as this video inspired a burgeoning Garry’s Mod artist Poool (then Poool157) to upload his own Splatoon GMOD animation, “Big City Slider Station” (according to his Splanimations archive article).

The two would be joined by Inspector Heavy (who formerly went by Pootis Heavy and made Team Fortress 2 Garry’s Mod animations) who started to make Nintendo Garry’s Mod animations and become friends with Alex and Poool. As he started to lean into SplatSource, he would later go by Heavy the Squid. While his account is gone now, some of his videos survive through reuploads, which I have embedded here.



Due to the low quality of the models at the time, work was done to make better models of the various Inkling characters. The Inkling girl was enhanced (A) first, then in the following months the Inkling Boy was also enhanced (A), further followed by other Splatoon characters. While these are screenshots of the SFM Community Workshop, they were also ported to Garry’s Mod; unfortunately, there aren’t any links to or screenshots that I could find of them because of something that happened almost a decade later.


Around the same time, Alex Spider followed up with “Splat Territory” (which featured his OC Inkura, probably the most famous SplatSource OC, relatively) and “Ridiculous Loop of Turf War” (riding the trend of "Vicious Cycle of (TF2 map)” that was popular at the time)


While SplatSource started to make the above people quite popular, SplatSource was still so small it wasn’t even considered a subcommunity, just part of the greater Splatoon community. However, with the release of Splatoon 2 in 2017, things would change for SplatSource. Super Mario 64 blooper YouTuber SMG4 released his video “If Mario was in… Splatoon,” introducing the then-Inkling character Meggy Spletzer (according to this video’s SMG4 Wiki article).

Her inclusion brought many people into SplatSource, as people who wanted to make fanart of her had to use Inkling models and Garry’s Mod. In fact, many people in this community (and some you’ll see in this OP) actually started out as SMG4 fans. At the same time, Splatoon 2 released and (predictably) sold very well, bringing many fans into Splatoon and trickling some into SplatSource. With all of this new blood from many walks of life, surely the future was bright for SplatSource, right?

Heavy The Squid​
(Heavy the Squid’s Splanimations Archives article)

SplatSource’s first major controversy starts with HeavyTheSquid, who was on the way to 50,000 subscribers at the time (making him no small name).
(To Catch a Squid, 1:31)

But as you probably already know, HeavyTheSquid was eventually exposed for his erotic role-play (ERP) with the then 15-year-old Ellie Godelia. It was so infamous that he even got an Encyclopedia Dramatica article.
Heavy's ED article

Being ahead of the curve, Heavy had a Discord server where he interacted with his fans. It’s disputed how Heavy and Ellie met; Doomsday.exe says they met over Discord, but LolAttack says they met over Steam.

Doomsday.exe:
Heavy, like many content creators, created a Discord for his fans. And this allows him to interact with his fans on a more intimate level. And it’s through this server, that Heavy met Ellie Godelia, a 15-year-old Splatoon and GMod player.


LolAttack:
The duo apparently met on Steam, so when Ellie saw the chance to start dating him, she took it without thinking of future consequences.

Either way, the two met sometime in 2016. Specifically, Ellie says she met Heavy in July, but didn’t start dating him until September (being 15 at the time). In a later stream (about a few months after Heavy left the Internet), Ellie implies that Heavy initiated, and she accepted then because she thought he was “the one.”
(To Catch a Squid, 1:55)

PickSurprise:
What age would you have been, when you started?

Ellie:
I believe… it was July when I met him- …summer, and we didn’t start dating until school started, which was September, and-

PickSurpise:
Okay.

Ellie:
Technically I was 15-


Ellie Godelia:
I didn’t date Heavy for fame, I didn’t date him for attention, I didn’t date him for… you know, subscribers or views, that's… really not it.

The main reason I dated him: I honestly thought he was the one, okay? I thought he was gonna be the one to help me. I thought he would be the perfect match for me. I personally thought… he was gonna be, you know… my Prince Charming, that’s what I thought, in the beginning. And knowing how stupid I was, I was wrong. And it only took me about a year to realize what type of person he was.

And believe me, there isn’t a single day where I regret dating him. Trust me on that. I… wish that I never said yes, to his offer of being his girlfriend, I wish that I never, you know, got to voice act for him, I mean, I wish I could’ve done better, but at the same time… when you really think about it, it’s my fault that I got myself into this situation, it’s my fault that I let him take control of me.

Heavy was so in love with Ellie that he talked about wanting to fly out to see her, knowing that she was under 18. Despite knowing her age, their RP quickly turned into ERP.
(To Catch a Squid, 3:10)(To Catch a Squid, 3:18)
(THIS YOUTUBER IS A SEXUAL PREDATOR!, 3:21)Heavy's ED articleHeavy's ED article(The man who “NEVER” admitted his wrong doings, 4:13)
Left / Second Screenshot:
Ellie Godelia:
starts dancing on a pole

Inspector Heavy:
Blushes crimson red and squeals❤️

Ellie Godelia:
shakes my butt

Right / Third Screenshot:
squeals and giggles ❤️
squeezes your booty
❤️

licks your sexy legs
cuddles

slaps your sexy booty❤️
gives you another french kiss❤️

strokes with his hands your body❤️

moans cutely and happily❤️
licks your stomach


I’m not sure if this was a DM to Ellie, but embarrassing nonetheless.
(THIS YOUTUBER IS A SEXUAL PREDATOR!, 8:47)
me wearing my sexy bath coat <3

Heavy also sent Ellie an unsolicited “nude” (a picture of him in nothing but his socks and underwear).
Heavy's ED article

Heavy and his defenders claimed that this picture was out of context, with one of his defenders Orange Inkling claiming it was a before-surgery photo that Ellie requested to see, while former friend TexanGamer13 said Heavy sent it to Ellie because she was concerned about Heavy’s obesity.
Heavy Amino post

Former friend and defender TexanGamer13 said that Heavy told him he sent the photo to Ellie because she said she was concerned about his health (because he was fat).

TexanGamer13:
But Heavy, like, came up with the excuses, when he, like, came in chats with me, and said some- (breath) -thing along the lines of like, “the picture was not a part of the sexual roleplay, it was just Ellie concerned of Heavy’s health, because… back then, Heavy was fat.

Ellie said she kept going because she felt pressured to, in fear of Heavy using his fans to attack her if she split up with him. In the Doomsday.exe video, she claims that Heavy forced her to continue the ERP, but no proof is shown for that claim other than her word.

Ellie:
Cause technically, here the thing: Heavy is, like, known as one of the most biggest people in the Splatoon community. And I knew that I tried to do something to pretty much cut it off, the whole community would split in half. And…

PickSurprise:
Yeah.

Ellie:
My guess was correct. Literally. When I broke things off with Heavy, EVERYTHING just went haywire.

PickSurprise:
Right, so, so, you kinda felt… pressured to.. To stay with before- before you broke up because of the backlash you realized it would have.

Ellie:
I didn’t know what to do-
(THIS YOUTUBER IS A SEXUAL PREDATOR!, 4:33)

Ellie’s fears weren’t unfounded, as Heavy tried to send his fans against someone named icerulerking, who initially leaked that Heavy was e-dating the then-16 Ellie Godelia all the way back in June 2017.
(To Catch a Squidette, 5:11)(To Catch a Squid, 3:42)(To Catch a Squid, 3:45)

Ellie did ultimately break up with Heavy a few months later on August 24, 2017, which is supported by his later apology video uploaded April 8, 2018.
Heavy’s Splanimations Archive article said:
Meanwhile, Ellie broke up with Heavy officially on August 24, 2017.

Heavy:
But… since we [Ellie and I] are now separated since 8 months…

Ellie told PickSurprise she broke up with Heavy for two reasons: a friend “helped her see the world clearer” and a Twitter spat between her friends and Heavy’s friends spilled over to her , which made her realize who she was hanging around.

PickSurprise:
Why would you say your relationship with him ended?

Ellie Godelia:
Technically, it’s- it’s kind of- okay, this is where it’s gonna get a little confusing, but…

PickSurprise:
That’s okay, go for it.

Ellie Godelia:
It was actually thanks to a friend of mine, I like, become- like, it helped me see the world a bit clearer, and-


Ellie Godelia:
Tina decided to explain- call Omega out on Twitter, and Omega called Tina the r-word. And- apparently then after that, both Heavy and Spider unfriended Tina, while Tina was just explaining what was going on while Omega was acting like…

It was like, it was childish, and (PickSurprise: Yeah.) really stupid, and when I saw that and like, looked at the messages on Twitter, I was just SHOCKED and horrified, and… I just felt like this huge w- wave of realization, slap me, like in the face, and I then realized, I had to get out. It wasn’t until then I then realized I was hanging out with the wrong people.

Heavy did not take kindly to this, and complained to his friends about it. TexanGamer13 recalled that Heavy said Ellie was cheating on him and she was racist, with the real reason for the breakup being that she hates Austrians and thought Heavy had a terrible accent! :story:

TexanGamer13:
Sometimes, like, I would hear- hear him, like, like, say stuff about Ellie, like, constantly over the years- year. And he would say, like, he would- like, Ellie was cheating on Heavy with “A Real User,” or what- whoever it was. And he also, like, said that he was accusing Ellie of being a racist, because he thinks that the real reason they broke up was because Ellie said that he ha- she hated Austrians, and she had- and he th- she thought he had a terrible accent. And I have to admit… I fell for it.
(Talk with Texan: Heavy, 3:20)

Ellie leaked her DMs with Heavy to a small group of friends, asking someone from Team Downfall to make a video. LolAttack makes his video publicly showing evidence of Heavy ERPing with Ellie around November/December 2017. At the time, it was quite controversial, getting mass disliked and taken down by Heavy’s fans.

LolAttack:
Once she released the info to a select few friends, she wanted one of us to make a video about making the news public. I was the one who made the video. I titled it, “Inspector Heavy’s Downfall.” Then, a few months later, I told the YouTuber called PickSurprise about the situation after seeing his Channel Checker on LizzieRatcicle. And then he took the evidence I gave him and made his Channel Checker on Heavy.

MediExcalibur2012:
But later on, Ellie and Heavy would both break up, which later on would prompt Ellie to contact LolAttack and notified him about what was actually happening in the DMs, in hoping that he could do something. LolAttack would then make his video exposing HeavyTheSquid, only for Heavy to find out and send his followers to mass dislike the video, resulting it to be taken offline.

From LolAttack’s evidence, PickSurprise made his Channel Checker video on Heavy, releasing it on February 18th, 2018 (sadly now private). As PickSurprise (at the time) was not connected specifically to the Splatoon GMOD community (and outside the reach of Heavy’s fans), this is when the topic started to spread past the Splatoon GMOD community.

Doomsday.exe:
And that was until February 18th, 2018. When YouTuber PickSurprise uploaded his video, detailing the specifics of their relationship, and what Reisenbauer had been doing to Ellie.

LolAttack:
With PickSurprise bringing the issue to light for an audience totally disconnected from the Splatoon GMOD community, more and more YouTubers started to cover the topic.

You might be wondering, “If a 24-year-old was getting with a 15-year-old, why didn’t anyone say anything?” The Splat Family Discord chat (who Heavy implies knew Ellie's real age, based on his response to icerulerking's callout) probably did not want to cause trouble with Ellie's relationship, while the wider public likely did not know their ages until PickSurprise’s video came out.

MediExcalibur2012:
After all of this had unwrapped, a video appeared out of nowhere, by the user PickSurprise, who managed to piece together and reveal to the public everything that was sent, everything that had happened, but most importantly: the ages between the two of them. Showing, with clear evidence to prove, that Heavy the Squid was a predominant and active sexual predator.

PickSurprise also revealed Heavy's IRL name (Philipp Reisenbaur) by showing his (now deleted) Facebook account in his Channel Checker video.

SoulEaterFan235:
Oh, one fun fact about Heavy! In PickSurprise’s Channel Checker video, he goes to show off his official Facebook account on a screenshot, in which he says that Heavy goes by the name of Philipp Reisenbaur. Now, I know what you all are thinking, “Hey, can we still find his Facebook account?” Well, apparently you can’t because he already deleted it. I mean, heck, I tried looking for it myself, and… Nothing.

In response to PickSurprise’s Channel Checker video, Heavy the Squid made various responses to the video, talking to quite a few people (some of whom reappear in later drama).

(To Catch a Squid, 5:31-6:02)

It wasn’t just Heavy who responded. Omega the Squid Man (one of Heavy’s friends and biggest defenders) threatened to dox Ellie’s face as a form of revenge for PickSurprise’s video.

Datura:
One day after PickSurprise’s video on Heavy the Squid, “Channel Checker - Heavy the Squid” came out, Omega sent somebody this message. “I have this bitch’s face reveal, I think it’s time for revenge!” And, uh, well… hi- his “plan” was to reveal Ellie’s face to the public as a form of revenge. (Sarcastically) Wow. Absolute fucking legend.

HeavyTheSquid later got into a voice call to explain his side of the story, resulting in some of the craziest lines I’ve heard from someone trying to defend themselves. This is a cut-down version of the voice call that was in the “To Catch a Squid” video, as the full original (supposedly on Soundcloud) is gone now.

Heavy:
I just wa- wanted Ellie should step down as a member of the Splatoon community, because she doesn’t deserve to be a member of the Splatoon community, and not being beloved because what she’s doing to me, is just fucking false news, just like Donald Trump but in an evil way. (Girl: -that's where I'm gonna have to stop it-) She’s just like Hitler, it’s what I can call her.

This fu-, fu- fe- thing, Ellie should drop it. And I- it’s already 5 months ago, and what happened back then with me and her, it should be in the past. She should forget it.

Why- then why the fuck was she- was she- was she just saying that I’m a pedophile then, huh? Should there- shouldn’t be for no reason whatsoever.

She has no evidence. (x4)

If I would be a pedophile, I would just rape kids- like 6 year olds in real life, but I never do that.

But, she- she- she- she treated me like- like an asshole. How would you- what you’re claiming about me, it’s false. And you should- you sh- should just stop lying. Just fucking jealous because I never get so much subscribers as this fuckin’ channel.

Guy:
She’s still a minor, and you’re a full grown adult. Ellie was 16, you are almost 26.

Other guy:
Heavy, pedophiles don’t have to be gay.

Heavy:
Well, she’s- yeah, but- but she pulled up this roleplay, not me.

Girl:
She basically bribed you into the roleplay, in order to…?

Heavy:
She- she brought up to the roleplay, just to pull up a trap, and she’s making me, as- as a culprit.

Eventually, Heavy decided to take a hiatus… for 1 day, and came back on February 28th. Right after this hiatus, he immediately interacted with CuteYoshiLover (then 16) and heart comments defending him.
1234
(To clarify, CuteYoshiLover is actually 16 at this point in time, her birthday is January 1, 2002)
(To Catch a Squid, 10:25-10:52)

One of Heavy’s fans, AlexAllStar14, even went into PickSurprise’s Discord server to chimp out at him in both text and voice, eventually bringing in his sister Lori to back him up. Unfortunately, the full thing is also private, so only this part seems to exist.

Pre-VC messages
AlexAllStar14:
I WANT A WORD WITH YA PUNK

PickSurprise:
oh aye

AlexAllStar14:
YOU GOT SOME NERVE FROM INSULTING OUR FRIENDS

PickSurprise:
i’m busy can you hurry this up

AlexAllStar14:
THEY DIDN’T DO ANYTHING BAD YOU BIG NIGGA

PickSurprise:
you done?

AlexAllStar14:
NOPE CUZ YOU ARE GONNA TELL ME WHY YOU ARE EXPOSING THE SPLATOON COMMUNITY

PickSurprise:
why you in caps

AlexAllStar14:
cuz i was yelling so i want to talk with ya in the general voice chat

PickSurprise:
okay join it
or just call me in dm’s

AlexAllStar14:
voice channel

Transcript
AlexAllStar14:
WHY DID YOU INSULT HEAVY AND CLAUDS! Stop lying, PUNK! ‘Cause I know you did that! You made one bad move! Well watch out, cause my sister is gonna expose your ass-

Lori:
Alright, what the FUCK?

AlexAllStar14:
You got some nerve for- trying to break us- break this Splatoon community apart!

PickSurprise:
No, I-

AlexAllStar14:
But we’re not gonna have that! We’re coming for you, punk!

Lori:
Leave the Splatoon community alone, and go fuck yourself! My boyfriend is literally right there, so…

AlexAllStar14:
So you better watch out, punk!

During Heavy’s “hiatus,” MediExcalibur2012 watches PickSurprise’s video and makes a Steam post warning others about Heavy. Omega then sent a scathing Steam message to MediExcalibur2012, unfriending him on Steam and blocking him on Twitter. Omega claimed to have evidence proving that Heavy was innocent, but being blocked meant that MediExcalibur2012 and others like him couldn’t see it and just had to trust his word.
(To Catch a Squid, 5:06)(To Catch a Squid, 6:34)(To Catch a Squid, 7:10)

When MediExcalibur2012 saw that Heavy went straight to talking to minors after returning, he started working on the “To Catch a Squid” video.

MediExcalibur2012:
However, very soon, later on, Heavy would come back after a one-day break, and would continue to interact with people under the age of consent. Realizing that this was a person with the potential to keep repeating the same actions as notified before, I went from social media posts to an actual YouTube video.

After it came out, Heavy expectedly responded, saying that the drama is old and it should be left in the past. He then publicly stated that he would delete negative comments, while semi-privately freaking out in his Discord server.
(Link below, also in THIS YOUTUBER IS A SEXUAL PREDATOR!, 6:19)(THIS YOUTUBER IS A SEXUAL PREDATOR!, 6:33)
(THIS YOUTUBER IS A SEXUAL PREDATOR!, 7:10)(THIS YOUTUBER IS A SEXUAL PREDATOR!, 8:20)(Heavy the Squid SNEAKS BACK IN?!, 2:12)(Heavy the Squid SNEAKS BACK IN?!, 2:13)
Imgur screenshot of Heavy's response/A

A day after MediExcalibur2012’s video, Heavy uploaded a video on April 8, 2018 titled “My True Apology.” While it did get deleted, there exists a reupload on the Internet Archive.

Doomsday.exe:
As on April 8th, Heavy the Squid uploaded a video entitled “My True Apology” to his main channel.

  • Heavy is very ESL
  • Heavy admits some parts of PickSurprise’s video are true
  • Heavy claims he did not attempt to sexually harass Ellie, and that he’s not a pedophile
  • Since Ellie is now 17, and will become 18 soon, if she stayed with him she would become the age of consent and it would be legal to be in a relationship with him (?????)
  • Heavy and Ellie split up 8 months ago (around August 2017), no way to fix the relationship
    • As a result Heavy decided to stay single and enjoy his single life
  • Repeats that he is not a pedophile
    • No interest in children, because he only has interest in adults, “like the age of 23, 20, and 18.”
    • Because he changed himself after his breakup with Ellie
  • Said that sometimes he started it and sometimes Ellie started it, it wasn’t only him forcing the roleplay.
    • Proceeds to repeat previous point
  • He “couldn’t say no,” is “just a guy who can’t say no so much”
  • Apologizes to everyone involved in the drama, is okay if you don’t accept his apology
  • Never intended for his friends to attack Ellie, he is not that kind of person after all
  • Just wants to distance himself from Ellie and start over, to continue to make Splatoon GMOD videos
  • To people thinking that PickSurprise and MediExcalibur2012 were lying, Heavy says some of it is true, but he is not a sex addict nor a pedophile
  • Repeats that he is a changed person who “only has interest to adults” and is still straight
  • Hopes audience understood, accepts his apology, apologizes to PickSurprise

As other YouTubers started to make videos on the drama, Heavy says in his Discord server that he will leave on May 10. Perhaps an attempt to leave the community as some sort of final apology? Nope, this was just a final middle finger to Ellie for ruining his Internet reputation. He was still adamant that he was innocent and Ellie was the one causing problems.
(Heavy the Squid SNEAKS BACK IN?!, 4:34)(Heavy the Squid SNEAKS BACK IN?!, 4:34)(Heavy the Squid SNEAKS BACK IN?!, 5:07)

When this was leaked, more and more people started to turn against Heavy in favor of Ellie.

LolAttack:
Heavy, being scum, decided that the best idea was to blame him deleting his YouTube on Ellie, in the hope that people would turn on her and send some of the hate her way. However, Heavy forgot that people outside of the Splatoon community have some common sense, and the complete OPPOSITE happened. Ellie got even more support and people hated Heavy even more for trying to shift the blame on the victim of his own sexual transgressions.

But the proverbial “final nail in the coffin” for Heavy was Doomsday.exe’s (frankly quite dramatic) exposé being released on May 4, 2018. After this video came out, the situation blows up and goes somewhat viral on the Internet.
(What happened to Heavy The Squid?, 1:42)123
(Last three are from Heavy the Squid SNEAKS BACK IN?!, 0:42-0:57)

The pressure becomes too much, so Heavy makes a final post on his Discord server, and actually deletes his YouTube channel around May 5, 2018 (based on the upload date of “What happened to Heavy The Squid?”).
(What happened to Heavy The Squid?, 1:58)

PickSurprise:
Now, if you don’t live under a rock, you probably would have seen this coming. But if you go and search Heavy’s YouTube channel, or try and click any links that lead to his YouTube channel, you will notice that the channel has been deleted. Not because of the staff at YouTube - as if they’d bloody do anything - or because of any sort of mass flagging; he deleted it himself.

The most surprising thing is that Heavy’s brother, Vito, had no idea what was going on. After Heavy deleted his account, Vito DMed Doomsday.exe on Discord, offering apologies to Ellie, Heavy’s subscribers, and the greater GMOD Splatoon community on behalf of his brother.
(Heavy the Squid SNEAKS BACK IN?!, 11:48)(Heavy the Squid SNEAKS BACK IN?!, 11:54)

While it would be nice for the story to end here with Heavy leaving the Internet forever, that was not the case. Both PickSurprise and Metokur predicted that he might come back under an alias.

PickSurprise:
If I had to make a guess, I’d probably assume he's going to come back under some new alias.
(Heavy the Squid SNEAKS BACK IN?!, 5:49)

This prediction turned out to be correct, as LolAttack, the guy who originally exposed Heavy the Squid, found him under a new account, called Wild Deadeye.
(Heavy the Squid SNEAKS BACK IN?!, 6:17)

LolAttack probably found the alias because Heavy didn’t even bother making a new Discord account for Wild Deadeye! :story:
(Heavy the Squid SNEAKS BACK IN?!, 7:07)(Heavy the Squid SNEAKS BACK IN?!, 7:20)

While the Steam account is gone now, someone (likely MediExcalibur2012) managed to archive the Steam page on the Internet Archive (A).
Wild Deadeye Steam account screenshot

There are many tells that this is Heavy’s alt:
One of the account’s previous Steam names was Emerald Squid. Pretty conspicuous for an alias of someone with a green Inkling self-insert.
(Heavy the Squid SNEAKS BACK IN?!, 8:23)

Another obvious thing is the account's friends, including MrMadness02, (fellow Splatoon GMOD artist who defended Heavy and was (and actually still is, A) in his Steam group), Awesome BOB Glitchy 4 (an account based off of an SMG4 character, Heavy was a fan of SMG4), fellow Splatoon GMOD creators “Wyvern the Pink Octoling,” Alpha Swan, Brian Jackson II, minor CuteYoshiLover, and his brother Vito.
(Heavy the Squid SNEAKS BACK IN?!, 9:40)Modern Steam group screenshot(Heavy the Squid SNEAKS BACK IN?!, 9:37)(Heavy the Squid SNEAKS BACK IN?!, 9:24)

Deputy Bart / Splat God also confirmed Heavy as Wild Deadeye, also stating that Heavy had changed his name to Cpt. Pootis while MediExcalibur2012 was working on his second video on Heavy. The Cpt. Pootis account also made a review for Garry’s Mod, stating that it is “Very Good to make Gmod Animations.”
(Heavy the Squid SNEAKS BACK IN?!, 7:37)(Heavy the Squid SNEAKS BACK IN?!, 8:59)

Eventually, MediExcalibur2012 released his second video on Heavy the Squid, “Heavy the Squid SNEAKS BACK IN?! - The Destruction and Aftermath.” At this point, according to TexanGamer13, even Omega eventually stopped supporting Heavy.

TexanGamer13:
Like, Omega now believes he’s a pedophile, because, like, he’s [Heavy] pretty much, like, backstabbed everyone and stuff. (breathes)

Heavy had deleted his (new) Discord server and cut everyone he knew online from his life, so after committing Internet suicide, TexanGamer13 pondered if Heavy had actually killed himself in real life.

TexanGamer13:
The reason for that [why TexanGamer stopped supporting Heavy] was because he has pretty much, like, cutted everybody from his life. Like, he has pretty much like, deleted his Discord server, yet again. He tried making another Discord server. Honestly, I didn’t blame him, because, like, some people are like- try- trying to like, find him again. But, at the time I was still like, try- trying to say- to him like, I was still trying to… help Heavy out, like I was trying- trying to keep- him like, keep him- him sane.

But… he’s pretty much like cutted everybody that was trying to help him. And he said like, there- he can’t trust them anymore, which is kind of stupid. So yeah, he’s... pretty much accused Ellie of being a racist, and he has… cutted everybody from his life. So, he’s pretty much committed Internet suicide. Well who knows, he may have actually did commit sui- in-real-life suicide. I don’t really know.

With his reputation ruined, Heavy the Squid had seemingly left the Internet for good. However, this would start a trend of the SplatSource community being unable to police itself regarding controversy, only really stepping up when bigger communities took notice (after all, Heavy the Squid kept defending himself, only leaving when Doomsday.exe’s video went viral, and even then, he still tried to return).
 
Last edited:
Ellie Godelia​
1 Ellie_Godelia.png

Being Heavy’s victim, Ellie got a lot of positive attention and support from the community.
(Heavy the Squid SNEAKS BACK IN?!, 1:22)(Heavy the Squid SNEAKS BACK IN?!, 1:30)
If you go to the first Heavy the Squid video by MediExcalibur2012 today you won’t see either a pin or a heart (this is related to some later drama).

In fact, she made a lot of comments on anti-Heavy videos, soaking up all of that positive attention.
123
(From To Catch a Squidette, 48:10-48:29)

It seems like both her time with Heavy and the positive attention messed her up, as she oddly made a Pixiv account where she posted NSFW of her character. While the account is down now, Ellie most likely posted stuff similar to what's under the spoiler.
(To Catch a Squidette, 16:32)
(Ellie Godelia’s Downfall PART 2, 6:33)

Later, on June 7, 2018, Commander Stealth spoke with someone who revealed that Ellie had 11 partners at once, even having to make a list to keep track of them all! When one of these boyfriends brought up his concerns about this arrangement, Ellie brushed it off as just “character shipping”.
(Ellie Godelia’s Downfall PART 2, 7:04)

LolAttack:
According to a video made by Commander Stealth, the person of whom he was talking to remembers her having 11 boyfriends at the time, holy shit!

Anon:
Literally how I felt- it’s like-

Commander Stealth:
Wasn’t she shipped with like, 5 different guys or something?

Anon:
A grand total I counted up was 11 people.

Commander Stealth:
11?!

Anon:
Yep.

Commander Stealth:
That’s more than double what I thought.

LolAttack:
When you say you have to make a list of all the people you’re dating, you have a bit of a problem!

It wasn’t just innocent romantic roleplay either, as she did suggestive roleplay with people she considered “family.”
(Ellie Godelia’s Downfall PART 1, 4:20)(Ellie Godelia’s Downfall PART 1, 4:24)

When Team Downfall investigated this, they found 7 people who Ellie shipped with: Tina Clementine, FederxBlue, Geofcraze634, Wraithhellborn, Blu Inkling / Shroom, possibly Erhu1234, and someone who wanted to remain anonymous.
1234567
(Ellie Godelia’s Downfall PART 1, 4:38-4:50)

When asked about Ellie, the anonymous person mentioned that roleplaying with her felt safe, and that Ellie supposedly also sent a nude.
(Ellie Godelia’s Downfall PART 1, 4:50)(Ellie Godelia’s Downfall PART 1, 5:03)

Shockingly, LolAttack was also one of the 11 partners, as Ellie tried to date him after Heavy was first exposed. LolAttack was 13 during the Heavy drama and when he revealed this.

LolAttack:
Ellie tried to date me. I wish I was joking. Keep in mind, this was right after I exposed Heavy for the first time. I was, and still am, 13 years old. She didn’t even bring up any characters we would be shipping, she just started hitting on me. I was naive at the time, so I rolled with it. I was in her puppet strings, of course I would act differently around her.

When this was brought up in an interview a few years later, Ellie claimed this was her just being affectionate and it didn’t last very long.

Delta225:
So, in this screenshot [LolAttack DM], I believe I’m still streaming it- yes, I’m still streaming it-

Pineapple:
Yeah.

Delta225:
Um, so, in this screenshot, uh, you are shown, um, engaging sexually with LolAttack, who at the time was, I believe, 13? And then-

Pineapple:
Yeah, thir- thirteen, the-

Ellie:
Kay, that… that was just me being physically affectionate, it wasn’t like w- not physically, more like- this was just me being my usual dumbass self-

Pineapple and Delta225:
Boycrazy.

Ellie:
Yeah. Like it wasn’t- I wasn’t like, trying to ask him for anything, like- I’ll be honest, a lot of people assume that we- that we dated- like, literally, I will confirm this right now; it lasted for one day!

Delta225:
Well, you still dated him.

Pineapple:
Well, it was a day, but we’ll reach out to LolAttack for comment.

Ellie:
I mean- I mean, I could be wrong, I don’t, like- but I feel like it was shorter than... that, but I mean, yeah it didn’t last long. (Pineapple: Like it was short.) I will confirm that. You know what, thank God it didn’t!

Pineapple:
Yeah, because you were 17, and he was 13. That’s, (Ellie: Yeah, obviously) at the most- the most genu- generous you could give that, is that he is someone who has a late birthday and he’s a high-school freshman, and you’re a senior; and that’s already extremely skeevy.

Delta225:
Extremely- extremely taboo, mhm.

Pineapple:
That’s- that is the best case scenario.

Ellie:
Yeah, obviously, but regardless, I’m glad it- I’m glad it didn’t last for- it could’ve been worse, it could’ve been a year, but thank God I cut it off by then. I don’t know who cut it off first though, if it was me or him- [...]

In that same interview, Ellie compared having all those relationships as akin to being on Tinder.

Ellie:
I don’t recall if I was in a relationship at the time, but-

Pineapple:
You were. With mul- with- multiple people.

Delta225:
With many, many people.

Ellie:
I mean, I was literally just scrolling through- like, you know like, the, uh, Tinder thing or Snapchat thing like, you scroll and swipe? It’s kinda like that, but with physical people.

Pineapple:
You were- you were just going up to any guy- [...]

Aside from being polyamorous, Ellie was supposedly manipulative. According to crueldude100, she gathered people to make them feel bad for her, and tried to control the friendships of an anonymous ex (the same one who saw Ellie nude).

crueldude100:
In her server, she always like gathers up people in the VC, like, “Oh look at me, I’m so sad! Help me, don’t do the stuff I do!” and then, um, she um- she changes her name to some edgy shit and same with her profile picture, and um… yeah.
(Ellie Godelia’s Downfall PART 2, 21:59)(Ellie Godelia’s Downfall PART 2, 22:02)

This manipulative behavior really showed itself after PickSurprise caught her on a lie. As said in Heavy’s section, Doomsday.exe claimed that Ellie asked to stop, but provided no proof of this. When PickSurprise pressed Ellie about this on May 7,2018, Ellie claimed that Heavy forced her to delete the messages of her asking her to stop. However, if this was the case, why didn’t Heavy force her to also delete the ERP messages?

PickSurprise:
As I was beginning to doubt what Doom had said in his video, I decided to directly question Ellie, to see if she could prove the things that Doom was taking claim to.

So I ask, “In Doomsday’s video you stated that you asked Heavy to stop the sexual roleplays, but he wouldn’t, is that true?” She says “Yes”. So I go on, “okay, do you happen to have any evidence that can back that up?” She replies, “Sadly no, he forced me to delete the messages and I had to comply.”

So you’re telling me Heavy asked you to delete the messages where you told him to stop, but he didn’t; but he didn’t tell you to delete the actual sexual roleplay messages themselves? My initial suspicions were right, there is no evidence there.

To deflect from this, Ellie pretended to be suicidal, and on June 4, 2018 sent a message saying that in 4 days (June 8, 2018, coincidentally the day after the 11 boyfriends thing was revealed) she will kill herself. While it isn’t known what the given reason was, the attempt was supposedly for something that happened in 2014.
(To Catch a Squidette, 26:34)

LolAttack:
Okay, so as seen in this chat log here, Ellie said she would kill herself in 4 days, and by the time of sending these messages, that would be on June 8th.

(Interviewer tells him Ellie faked the suicide because of some event 4 years ago)
Ex-admin:
You’re telling me, 4 years ago, something that happened 4 years ago, before ANY of this even happened, and you’re gonna hurt- hurt- harm yourself in this way, over something 4 years old?

As she stated in that DM, on June 8, 2018, Ellie joined a voice call with LolAttack, crueldude100, erhu1234, and AwesomeJCR, pretending to choke herself. Then after being “unconscious” for 6 minutes, she magically came back to life after being saved by her cat. :story:

Note: this is an edited version of the audio from the video, with most of LolAttack’s rebuttals cut out.
(From 6:01-6:36)
crueldude100:
She’s okay, I just heard her.

(Ellie starts making choking sounds)

erhu1234:
Ellie?

AwesomeJCR:
Ellie? Ellie-

Ellie:
Can’t… breathe…

crueldude100:
(unintelligble)

Ellie:
I can’t… breathe…

AwesomeJCR:
Ellie, are you choking?!

crueldude100:
Ellie, what’s happening-

Ellie:
Help… help me…


(From 6:58-9:32)
erhu1234:
Wait, I hear her breathing!

(Ellie starts coughing)

LolAttack:
She’s good, she’s good.

AwesomeJCR:
Ellie?

erhu1234:
Ellie?

crueldude100:
Ellie…

AwesomeJCR:
Is it off your neck yet?

Ellie:
What… what happened?

(Switches to LolAttack rebuttal)
LolAttack:
Okay, if she was actually choking in this moment, SHE SHOULD BE FUCKING DEAD. According to research, it takes about 3 minutes for a human to die of asphyxiation. Ellie was out for about 6. If science applies here, she shouldn’t have been able to wake up. Oh, and for those people who were thinking, “OH, IT’S A FUCKING MIRACLE, SHE’S STILL ALIVE!” she wasn’t even trying to kill herself. There is no fucking miracle.

(Back to call)
(Knocking sounds from Ellie’s Discord)
AwesomeJCR:
Hello? Is someone knocking at the door?

LolAttack:
Ellie’s…

erhu1234:
Think- she's...

crueldude100:
The fuck?

(After she “woke” up)
Ellie: I think…

erhu1234:
There’s someone knocking on the door.

AwesomeJCR:
Whoever they are-

LolAttack:
Fucking hell, dude.

crueldude100:
No, listen up; we only heard knocking though, let’s just, uh- we would have heard the door open, heard someone walk in, potentially scream. So, Ellie must have got pretty fucking lucky for that noose, or whatever you used to choke yourself, to actually get untied when you fell to the group. Holy shit.

LolAttack:
(sigh) Is that all the stuff you need or do you want me to keep going? Okay.

Ellie:
But, my parents aren’t home…

LolAttack:
(flabbergasted) Then who knocked on the door? Who knocked on the door?!

AwesomeJCR:
Just promise us you won’t do that again, please.

Ellie:
I’m so sorry, I’m sorry…

crueldude100:
What was that- what was that knocking going on?

erhu1234:
I have no idea.

Ellie:
Knocking?

erhu1234:
Yeah, someone's knocking at the door!

crueldude100:
We heard knocking and a ton of banging. We was able to stop-

Ellie:
I… I don’t know, the doors are locked and my… unless…

(From 9:38-9:46)
Ellie:
If my parents weren’t home, then… maybe it wasn’t a human. It was a cat!

(From 9:51-10:04)
Ellie:
Augh!

crueldude100:
You okay?

AwesomeJCR:
Ellie?

LolAttack:
Uh, Ellie, did you fucking choke yourself again?

AwesomeJCR:
Ellie, are you stuck?

Ellie:
No, there was… blood coming out of my stomach!

(From 10:14-12:04)
Ellie:
Why are there scratches all over my legs?

AwesomeJCR:
Was your cat in the room with you?

LolAttack:
What…

Ellie:
Wait a minute, if no one was- it- maybe it wasn’t a human…

erhu1234 and LolAttack:
What?!

AwesomeJCR:
The cat saved you!

Ellie (with LolAttack laughing in the background):
Cody! Cody saved my life!

erhu1234:
What?

Ellie:
Is- he’s- I think he’s still here.

AwesomeJCR:
Well, if he is, you may as well give him a hug and a kiss.

Ellie:
Course, Cody was always loveable and fun. I- I think, I do remember seeing s- when everything turned black, I could hear voices.

LolAttack:
What?!

Ellie:
All of them were saying, "Don't give up." It’s not over.

LolAttack:
Oh, what the fuck?

Ellie:
They were basically telling me to not give up. Then, I hear a tiny meow, and then... I see... I then- next thing I knew, I just found myself on the ground! If my parents weren’t home… maybe it wasn't a human... it was a cat!

crueldude100 asks Ellie what she tried to choke herself with; Ellie says it was a bathrobe at first (now “torn, to the very brim”) but later in the call Ellie changed it to a rope. The guys also ask for pictures of the injuries; Ellie first say she doesn’t have space but later in the call says she simply doesn’t want to send pictures.

Note: this audio file is also edited to cut out PickSurprise’s rebuttals
(From 30:48-31:02)
crueldude100:
What did you even try to choke yourself with? Was it a noose, and if so, is it all scratched up and torn on the back?

Ellie:
It's a... bathrobe... string.

crueldude100:
Bathrobe... is it all, like, scratched up and torn?

Ellie:
Oh yeah, it's torn, to the very brim.

(From 31:41-32:04)
Ellie:
Oh yeah, they're deep. There are bruises all over my neck, probably from the rope. I can't take pictures. It literally says "There's not-," damn it.

crueldude100:
You can just delete- unused pi-

Ellie:
Yeah, it says, "Cannot take photos; or to take a photo you must add storage.” Ugh! Lousy Apple product! One photo won't be enough to delete. I have to delete multiple things, or an app.

(From 32:08-32:15)
LolAttack:
Okay, I think we’re getting the two-

Ellie (talking underneath LolAttack):
I really don't want to send any, no offense.

crueldude100:
Your neck though, but like not your stomach cause that would be weird.

Ellie:
No thanks.

If you're wondering why the cat "saved" her, Ellie came up with that because her cat happened to walk into the room as she was trying to choke herself.

Delta225
Okay, um-

Pineapple:
DJSwaggy really wants to mention- mention, why you came up with the narrative that your cat saved you?

Ellie:
I don’t fucking know, I… I was just… fucking… I literally… (sighs)

Pineapple:
You wanted an excuse for why you didn’t die-

Delta225:
For how you survived.

Ellie:
It was literally the first thing I came up with because he literally came into my room, saw me crying, and was meowing at me, and… it just- it just seemed like a good idea at the time, I guess? Like I said-

Pineapple:
Yeah, a good scapegoat for why you survived, without just saying, “Dude, guys, this was just a suicide-bait.”

Ironically, Ellie allegedly didn’t care when the anonymous ex felt suicidal.

LolAttack:
Okay. What REALLY pisses me off is that… when the anonymous ex said to Ellie that he was feeling legitimately suicidal, did Ellie care? Fuck off, she thought he was a tool, a fucking TOOL, that outlived its usefulness.

Anyways, Team Downfall managed to get an interview with the person who revealed that Ellie had 11 partners. This person was actually an ex-admin of Ellie’s server, and what he says matches up with what has been shown about Ellie so far. The silent parts are the audio of the interviewer asking questions being removed, it was like that in the original video.

  • Is what the ex-admin will say all the truth, nothing but the truth, "so help you God?'
    • Yes
  • Experiences with Ellie Godelia?
    • Was friend and staff, until she started to hit on him
    • Was directly told she wanted relationship, she got mad when ex-admin reject her
  • How has Ellie used you and others for her needs and wants?
    • Ex-admin brought in as staff week after joining
    • Things started to get worse after Ellie hit on him
    • Ellie keeps trying to use ex-admin to talk to Commander Stealth
      • Every time Commander Stealth was online, Ellie pestered ex-admin (Finn?) to talk to him for her
      • Most recently contacted him on the 19th (June 19?)
  • Anything to say about Ellie's 11 boyfriends?
    • She actually has 14
  • She has 14 boyfriends?
    • Ex-admin thought it was just for fun, but it's serious
    • Brings up her smoking and her trying to kill herself
    • She needs help, references the "He need some milk" Vine
    • Whole thing is falling apart because of Ellie's games with her 11 boyfriends
    • She may become the next Heavy and Omega
    • Sad because Ellie was innocent at first, didn't have to devolve this way
    • Ellie shouldn't have been in charge of a Discord server, but the Splatoon community is, "where 29-year-old men can act like 9-year-olds"
  • Opinion on staff in Ellie's Discord?
    • Ex-admin left back in late 2017
    • Heard lots of good things about Mage Kid at first, now hearing bad stuff; supposedly did a hostile takeover
      • Wonders if Mage Kid is one of Ellie's secret lovers
    • AwesomeJCR was put into admin immediately, became a "cheeky little cunt" when he was chill before
  • Thoughts on Ellie's fake suicide?
    • Was surprised to hear about that
  • Interviewer confirms she did that, gives more details about it
    • Ellie needs to check into a hospital, any kind
    • Horrible because
      • Permanent solution to temporary problem
      • Tried to do it in front of her friends
        • Interviewer accidentally talks here and his voice isn't removed
    • Ellie should have went to her staff/friends for help, not fake a suicide in front of them
    • It's all Internet drama and she's young, she shouldn't have taken this path
  • Reason Ellie gave was something 4 years ago
    • Ex-admin is flabbergasted to hear this was supposedly because of something before all of this drama
    • She shouldn't have done that in front of staff, this is why people can't trust her
    • Saw Ellie ERP in staff chat with random who wanted staff role
    • Sees Ellie as mentally unstable, unhappy, depressed, sad child
      • So sad because she's young and Internet drama doesn't really matter
    • Ellie needs to unplug the computer and enjoy nature outside
  • Does Ellie show favoritism?
    • Yes, very true
    • After fallout, held staff meetings with only favorite people and deliberately left everyone else out of the loop
    • Kicked active people she didn't like, replaced them with inactive people from her Amino chats
    • Talks about 2 people who took RP too seriously, brings it up because RP plays into favoritism
    • Ellie put people into staff roles based on how much she liked them
      • Ellie tried to hit on every staff member once or twice, managed to get some into relationships
    • Kicked people out because friends didn't like them
      • Mage Kid was beefing with two people, Ellie took Mage Kid's side and kicked them both
  • Anything to say to Ellie Godelia?
    • Turn off the computer, go outside, and enjoy real life
    • Being on the Internet is the reason for all this nasty behavior Ellie is showing
    • Only way to find true happiness is to find it yourself
    • Do something other than being on the Internet

While most of this stuff was known by and released with Part 1 of Ellie Godelia’s Downfall, some parts (most notably LolAttack’s DMs with Ellie and the interview with the ex-admin) weren’t released until Part 2 came out. As seen in a reaction video by a then-small text-to-speech commentator Flying Scott, Part 1 was released on June 29, 2018.
(Ellie Godelia's Downfall - REACTION, 7:12)

After Part 1 was released, LolAttack sent the video into Ellie’s server and left, causing drama. Many people left, Ellie played the victim, and her staff took her side.

LolAttack:
So, after I posted the Downfall to Ellie’s server and left, everything just… kind of… crashed. Including her server. Meanwhile, Ellie was playing the victim yet again, that’s always fun. Notice how she changed her profile picture right after being questioned. This isn’t a rare occurrence either, she did the same thing when she faked the suicide. From now on, we are calling this as “attention hunter syndrome.” And of course, her staff instantly took her side because they’re all under Ellie’s fucking puppet strings.

Ellie was then invited to a group DM by her friends to figure out what was going on.

Note: this is also an edited-down version to remove LolAttack’s rebuttals. I’m also guessing here as to who’s speaking; I didn’t recognize any of these voices or profile pictures besides Ellie’s.
(From 1:32-1:50)
Squidly:
Now, just relax. It’s gonna be okay.

Ellie:
Just, what do you want to ask me?

Squidly:
We’re just wondering, what’s going on, like, what-

Ellie:
I- I really don’t know. I wish I knew, but I don’t. I really don’t know.

(From 2:01-2:17)
Squidly:
No, no, I mean, look at the like-ratio and stuff. Oh my goodness!

Ellie:
Wait, is the like-ratio a good thing or a bad thing? I can’t-

Squidly:
There’s like 7 people so far who’s liking it! There’s 7 so far.

Ellie:
Is that a good thing or a bad thing?

(From 2:19-2:40)
Squidly: Mmh. Actually, there’s 30 now, 30, holy shit!

Rayman:
Yeah, from my perspective it’s around 29 likes, and 3… although it might be my-

Ellie:
If you guys want the truth, I’ll tell you, listen, listen. The people I’ve shipped with, they’re just OC ships, there’s nothing wrong with that, right?

(From 2:51-3:00)
Ellie:
Like, charac- like fictional character shipping. You’ve done it Tessu, I’m sure you’ve done it, Squidly, Rayman’s (Squidly: Yeah, but-) done it, we’ve all done it!

Rayman:
Yeah-

(From 3:11-3:14)
Rayman (continuing from previous section)
But uh…

Ellie:
So what’s the big deal?!

(From 3:25-3:33)
Ellie:
And, like, some characters were actually birthday presents to other people, like, I gave my Callie-sona to Geof as a birthday present.

(From 3:38-3:50)
Ellie:
Same goes with another character I gave JCR. I gave E- one of my OCs, Edgellie, to him as a birthday present… last year on Valentine’s day.

(From 3:58-4:04)
Ellie (choking up):
I was just trying to be nice, you know? I was just trying to do the right thing…

(From 4:10-4:28)
Squidy:
Now I have a- one question as well: I- in the screenshots in the video, is- some people say you started to manipulate them, is that true or not?

Ellie:
No, not at all. I wouldn’t do such a thing.

Squidly:
Mmh. Ish-

Ellie:
Not- at all.

(From 4:30-4:41)
Ellie:
I don’t w- I- don’t- I would never- look, okay, I can put up with being called names, but I cannot put up with my friends getting dragged down.

(From 4:48-5:03)
Ellie:
I really don’t know though, I wish I could give you an answer, but I don’t, but I can assure you I would not do any sort of things. I admit, I’ve made mistakes. I regret them whole-heartedly. I honest-to-God do.

(From 5:12-5:25)
Ellie:
All I can say is this: if you want to believe those rumors, be my guest. But… all I can tell you is this: I am not the person they say I am.

Ellie started to hide out in private, such as her private Steam account Xielle or a new Discord server called the “Snootaloot Server Squad” that only included her best friends.

LolAttack:
On Steam, as of now, she remains in hiding on a private account called X… Xi… Xylophone? Xiel- yeah, Xielle.

LolAttack:
Speaking of her friends, Ellie created a new server called the Snootaloot Server Squad to hide from her hate. Only her best friends are allowed in, but all around they have, like 45 members.

While Ellie was hiding out, her friends made excuses for her when people asked Ellie to apologize, such as her being “at summer camp” (which she already came back from) and “her stuff got confiscated” (she was then-recently seen active in on Discord).

(Ellie Godelia's Downfall PART 2, 25:44-25:57)

Some of Ellie’s friends, like Brewster T. Koopa, claimed the Downfall was made purely to attack Ellie, but this accusation falls somewhat flat given that he is called “Daddy Godelia” in the Splat-Family Discord server.
(Ellie Godelia's Downfall PART 2, 22:52)(Ellie Godelia's Downfall PART 2, 23:00)

Speaking of the Splat-Family, Team Downfall theorized that the “family” structure was a way to hide Ellie’s polyamory, as Geofcraze634 (one of its members) was heartbroken to find out about Ellie’s 11 boyfriends (some of whom happened to be fellow “Squid Sibs” in that Discord server).

LolAttack:
The word “daddy” was taken literally in the server because 1: there are a number of people who are considered Ellie’s family in the server. This leads right into reason 2: The family structure was a cover up to hide the people with whom she was dating. Why do you think Brewster was called, “Daddy Godelia?” And given that Ellie can’t get enough of polyamory, of course she would try to hide everything. Here, look at this.

crueldude100:
Alright, so… this is where it started. So, Flora posted this- about this, uh, screencap that he took… of Stealth’s video with the title of, “Ellie with 11 BOYFRIENDS?” And he- And then Geof comes in here, saying “Uh oh.” And then… here’s where he hints that he probably did do something with Ellie. “Oooh, if Ellie’s using me, then why does she had a lot- have a lot of boyfriends?” (unintelligible), his English sucks.

And then see, look, then he says, uh, then I say, “What do you mean Geof? Don’t tell me, is she dating you?” And then he writes, “I thought she only likes me, she really RP on me, and I did too.” Look, see, roleplay. And at this point, we probably know what roleplay… he’s mentioning, because here he is getting all sad because Ellie with 11 boyfriends, and he’s saying she’s using him, probably, and he thought she only likes him, and then he says, “Why is she doing this?”

And then here I get pissed off, because this is just like the 12th boyfriend to add to the list. And then here I mention down some people that she did date. And then, he said, “Well shit, I’m a part of it.” So, and then he asks, “How can I trust her, she’s trying to brainwash me by her RP,” and then he says, “What the hell, Ellie?” And then Geof says that Ellie has decided she liked him and then Ellie kept saying that she loves him.

And then, this is where it ends. And then “In RP” again. So, Ellie, I guess, in a way, fucking did, uh, sexual roleplays with Geof, and he I guess in- for some odd reason wasn’t aware of… all the other dudes that she was dating in the past and was dating at the time. Mostly to see the sex roleplay with him. Uh, that’s all that’s to show, cause, well the conversation ends cause this rule says no venting right here. #general, so. Yeah, that’s all.

LolAttack:
Alright.

One of Ellie’s exes, Squiby Squid, made a video detailing his relationship with Ellie after Part 1 came out. When talking with him, LolAttack found out that Ellie also flashed herself to this guy (who is 14), and then painted him as a stalker to keep her friend group away from him.

(Ellie Godelia's Downfall PART 2, 23:06-23:09)
(Ellie Godelia's Downfall PART 2, 23:23)(Ellie Godelia's Downfall PART 2, 23:49)

When asked about it years later, Ellie claimed all of the messages were just roleplay.

Pineapple:
Um, so here is you engaging with- with one of your… boyfriends at the time, Squiby. A-

Ellie:
Okay, that.

Pineapple:
A four- a 14 year old going on 15, so, once again, 3-year age gap.

Delta225:
Mhm.

Pineapple:
Would- would have been his- a 3-year age gap. Not horrible, however…

Ellie:
Okay, I mean, I was responding to that, because I mean…

Pineapple:
However…

Ellie:
I mean, be-

Delta225:
Let Pineapple finish.

Ellie:
Oh, go on.

Pineapple:
Yeah, however, as we go to the next- uh, just you, and you two asking… asking if you can be in a relationship, all of that, and then the next-

Ellie:
I mean, I- I- I- I legitimately thought it was for roleplay purposes.

Pineapple and Delta225:
Eeh…

Delta225:
That being said…

Ellie:
Not for… not-

Pineapple:
Yeah, no, “Does anyone know we are shipping?” so, yeah that makes sense on the surface, but you said, “No, but I think it’s better to keep that- that way.”

Delta225:
“Because I don’t want anything to happen to you.”

Ellie:
Like okay, again, that was for, like roleplay purposes. It wasn’t meant for like, official ship- like IRL dating or all that, it wasn’t meant like that, (Pineapple: Well…) because…

Ellie did something similar to an anonymous ex (different from the anonymous ex mentioned in Downfall part 1), where she claimed that ex gave Dr. Serpentina a seizure and edited DM screenshots to imply that he was the sexually dominant one, to turn the staff against him.

(Ellie Godelia's Downfall PART 2, 24:22-24:55)

While writing Downfall 2, LolAttack found out that the day after being hit on by Ellie, Ellie went after his 15-year-old friend intending to ship their characters together, despite knowing that LolAttack’s Inkling OC was shipped with his friend’s Octoling OC at the time. Ellie later claimed that she thought the shipping wasn’t serious and the friend initiated first.

LolAttack:
Now, while I was writing this video, I was sent something that will seriously add to this case. One day after Ellie sent those loving messages, she started hitting on one of my best friends. She specifically mentioned her main inksona kissing their octosona. And she knew my inksona and his octosona were shipped at the time. And the zinger? He was 15.

Ellie:
I mean, from what I remember, if I recall correctly, I believe THESE two… uh, LolAttack and the other guy, they were very close and they were shipping their characters with each other, right?

Pineapple:
They were.

Delta225:
They were.

Ellie:
Okay, so like, I just… believed it was all for fun and games and all that, like I didn’t think it was serious, but regardless…

Pineapple:
You shouldn’t have done it-

Delta225:
You shouldn’t have done it in the first place.

Ellie:
I believe his friend showed genuine interest in me and I was like, flattered at the time.

And finally, according to his brother Vito, Heavy actually watched Part 1 (evidently not killing himself), thanking Team Downfall for making the video. Despite how Heavy got eviscerated, there were still Heavy defenders who used Team Downfall’s Ellie video as proof Heavy was innocent all along. While Heavy was now cool with Team Downfall, LolAttack clarified that Heavy is still not innocent.

LolAttack:
It turns out Heavy actually watched Part 1 and is self-aware about his mistakes. As far as we go, Team Downfall and Heavy are on the same page. We’re good. So Heavy, if you’re watching this: hi, how are you doing? Okay, so people have been commenting that just because Ellie got exposed, Heavy is completely innocent. I know he’s watching this so I’ll go lightly. Heavy still inno- isn’t innocent in this case. Heavy is cool with the team but it doesn’t mean that all evidence goes away.

Eventually Ellie faces the music, as on August 21, 2018, she goes live to discuss the fake suicide attempt. The original stream (titled “The Truth Stream”) was deleted, so here is a reupload by Datura.
PreserveTube
  • Unscripted and Ellie likes to ramble a lot
  • Has been struggling with anxiety, depression, and trust issues for the last 2 years
  • Knows what she did was wrong and knows she shouldn't have done "those things," is very vague about what she did
  • Shipped fictional people/OCs because she was desperate to fit in
  • Feels responsible for everything she's done
  • Had a breakdown "last night" for 2 reasons
    • Working on document for past 2 months to explain what she has been doing, how she has been handling this, and what she truly thinks
    • Doesn't explain the second reason
  • Says "they" (implying Team Downfall?) aren't doing bad things, in fact what they did was beneficial to her
  • Tells audience that if they want to see document, get the livestream to 10 likes
    • Half a minute later, she gets 10 likes and she goes to her room
  • Was originally going to react to first Downfall video on release, but had to got to college camp
  • Aware of video, kinda cares but also doesn't for 2 reasons
    • Drama is everywhere
    • Knows she can be quite affectionate towards people she can truly trust, but could have handled stuff differently
  • Someone in chat named "Liberty Prime" starts talking about politics, Ellie threatens to ban him
  • If video gets 20 likes, stream can see her eating breakfast; if stream gets 30 likes, she will do a Q&A
  • Goes to eat breakfast, finishes her taquito in 20 seconds
  • Shows the document, is blurry so she tries to wipe the camera and actually makes it blurrier
  • Ellie dated Heavy because she thought he was the "one," should have never accepted his offer
  • Ellie says what she did was a few simple mistakes
  • Ellie starts talking about the fake suicide attempt, then says if the stream gets 3 more likes she will explain
    • Justifies it by saying she is trying to gauge interest in the topic, doesn't want to make viewers uncomfortable
    • Gets 25 likes, starts talking about it
  • Ellie shows the bathrobe string she supposedly hung herself with (surprisingly intact instead of being "torn, to the very brim")
  • Talks about what kind of knot she used, first says double-knotted, then walks it back to simply tying it
  • Said she tied it around her bedframe post, she moved forward and "stopped breathing," passed out
  • Ellie's cat supposedly untied it, claims the cat was able to untie a knot Ellie couldn't get out once
  • Says that suicide is not the answer, she only did it because she was "very very" broken and upset at herself and the people she hurt for a long time
  • She is grateful for not succeeding, repeats that suicide will not help and you will not only hurt yourself but others
  • Not proud of doing it
    • Says, "After getting a tiny taste of death, I never want to do it again," and says the audience can trust her on that
  • While talking about self-doubt and lack of confidence, her phone starts to die (2% battery)
  • Switching to laptop, having tech trouble
    • If she switches, she needs to block the camera
  • If the stream gets 30 likes, she will do the Q&A
    • Gets 31 likes, starts to switch over to her laptop, and the stream ends

Sometime in October (based on these screenshots from Datura’s video on Ellie Godelia), PickSurprise uploaded his Channel Checker videos on Ellie Godelia. According to Flying Scott, these and the Downfall videos made Ellie irrelevant in the community.
(Datura’s Ellie Godelia video, 22:13)(Datura’s Ellie Godelia video, 22:21)

Flying Scott:
After all, after the Downfall video and PickSuprise’s Channel Checker on her in late 2018, Ellie was not relevant to the mainstream anymore.

Ellie later apologized “for real” sometime in 2019, being accepted by the community and regaining relevance. This apology was apparently good enough that Team Downfall was willing to take her (being featured in their channel banner before May 6, 2019), supposedly to redeem herself and show that she could change.

TrueLegendary:
Now, in early 2019, Ellie apologized to the community for real, and people forgave her.
(Where Are They Now? 1.0, 3:33)

Flying Scott:
When Ellie joined, it was to show that people that TDF covered could redeem themselves.

At this time, Ellie remained under the radar, although she popped up in other controversies throughout 2019. It is undoubtedly true that Heavy is guilty of ERPing with Ellie, but due to Ellie’s whoring (of the attention and digital kind) making her an unreliable narrator, it was hard to know what was real and what was her possibly exaggerating for attention.
 
Last edited:
Brian Jackson II​
(Brian Jackson II’s Splanimations Archive article)

What makes Brian Jackson II special is that he was the poster child of being unable to take constructive criticism. He claimed he would change, but it will be quickly obvious that he did not.
(Talk With Texan: Brian Jackson II, 1:27)(Talk With Texan: Brian Jackson II, 1:28)(Talk With Texan: Brian Jackson II, 4:36)

Brian's inability to take criticism was exacerbated by his anger issues, exemplified when the Heavy drama made his friend DonutJoe93 / Spingebill Nye leave and when he had to deal with an imposter (which is still up to this day, A).
(Talk With Texan: Brian Jackson II, 3:27)(Talk With Texan: Brian Jackson II, 7:41(Talk With Texan: Brian Jackson II, 7:30)(Brian Jackson II's imposter YouTube account)

What really started his spiral was when LolAttack criticized Brian’s video “Special Eggnog” sometime in January 2019. As expected, Brian got mad at LolAttack, although they later made up.
(Talk With Texan: Brian Jackson II, 1:35)(Talk With Texan: Brian Jackson II, 4:39)(Talk With Texan: Brian Jackson II, 4:40)

Things started going bad for Brian, as after this the previously-mentioned imposter who Brian inevitably raged at showed up. Brian also had to deal with his “best friend” (that he just randomly declared to be so one day) VenomKnight827 blocking him, which distressed him so much that Brian was begging VenomKnight827 to become friends again, and even sent Skylar Karategirl to try to convince him.

TexanGamer13:
This is probably where the whole thing with him started to fall apart, when a friend of his, or a former friend of his actually, had blocked him because like, the whole thing that he has been hearing. Friend of his by the name of VenomKnight. And he obviously did not take it lightly. Hell, he’s even tried to get people to try to get Venom to re- re-friend him.

Obviously it didn’t work, because Venom had made his decision. It was his decision, so… I don’t think he really needed to worry about it. I mean it’s not like they really talked with each other that much, anyway. BJ and Venom don’t really… speak to each other during that- er, during their time, when they were friends that much. But first time they were friends, and this is kinda off-topic here; BJ pretty much like, made a little picture from his- with his help, with a lot of girls just like, hugging and kissing him, or something like that. And he just claimed that Venom was like his new best friend, when they had just met that day.

Two bigger SplatSource creators, LizzieRatcicle and ghostoftime1, unfriended him after an argument about from Brian trying to force Big Chungus and Ugandan Knuckles into a video.
(Talk With Texan: Brian Jackson II, 3:55)(Talk With Texan: Brian Jackson II, 3:57)

Joxic:
I did have- I did mention this, is that you and… uh, Ralph, or ghostoftime. (LizzieRatcicle: Yeah.) You disconnected with him because of creator differences. Do you mind if you can elaborate on that?

LizzieRatcicle:
It started back in 2019, so… If I remember correctly, I think it’s when he- when- when Brian Jackson just came up with the idea of, uh, another idea. I forgot what it’s called, but I think he mentioned something about the “Big Chungus,” and-

Joxic:
Ugh! Jesus Christ, no, I did not like to hear that name. (chuckles)

LizzieRatcicle:
Uh, and- ghostoftime1 did- wasn’t really happy about it, he does not like that meme. I (Joxic: Yeah, understandable.) don’t like that meme either, not it- and he- and it’s not- and it’s not gonna happen, and- (

Joxic:
Mhm.

LizzieRatcicle:
I think-

Joxic:
So, the reason why is that like, he just had shit ideas, basically.

LizzieRatcicle:
Very shitty ideas. (Joxic chuckles)

Brian did not take too kindly to this, likely because they were big creators and he might have had a crush on LizzieRatcicle.
(Talk With Texan: Brian Jackson II, 4:23)(Talk With Texan: Brian Jackson II, 5:33)

Brian Jackson II was also getting pedophilia accusations for his interactions with Lori (13, supposedly flirting with her as a joke) and CuteYoshiLover (17, creeping her out). While I think how he spoke to them was kind of creepy, I wouldn’t call him a pedophile for it, as it seems more like he didn’t know how to talk to women properly.
(Talk With Texan: Brian Jackson II, 1:35)

TexanGamer13:
But, this happened a long time ago, because BJ thought it would be the best idea to “flirt” with Lori. (followed by “As a joke” on screen)
(Talk With Texan: Brian Jackson II, 9:55)(Talk With Texan: Brian Jackson II, 10:07)

Even Skylar Karategirl got fed up with Brian, as she was the one who cleaned up after him, culminating into RudyOctolingGamerVA, Skylar, and TexanGamer13 all unfriending and blocking Brian.
(Talk With Texan: Brian Jackson II, 6:06)(Talk With Texan: Brian Jackson II, 6:16)

TexanGamer13:
What led me into making this video was something that had happened after me, Rudy, and Skylar unfriended BJ and blocked him.

According to Ellie, Rudy also made a callout post on Brian to disassociate from him, which caused TZelda to harass Rudy to the point of considering suicide.

Ellie:
So, as some of you guys know… my friend Rudy, Octo Rudy, um, VAGamer, you know, Rudy, the Octoling? The one that appeared in TehCanadianSpartan’s video? (sighs) I love the guy. Anyways, she, last night, was bullied into suicide- don’t worry, she didn’t commit suicide, she was bullied into suicide, because SOMEONE thought it would be a good idea to bully her because she made a callout post because she wanted nothing to be associated with Brian Jackson, and- [...]
(Talk With Texan: Brian Jackson II, 10:30)

Once TehCanadianSpartan (one of Rudy friends) found out about what Brian did to Rudy, he angrily DMed Brian and created the hashtag #EndBrianJackson.
TCSBJdm1.jpgTCSBJdm2.jpgTCSBJdm3.jpg(The #EndBrianJackson Problem Google Doc)
(First three are from TheCanadianSpartan Dropbox\TCS Anger issues folder, no direct link/archive to the last because it's been deleted)
It’s implied that TehCanadianSpartan took credit for being the one to take down Brian, overshadowing the people who actually helped out.

Zeldaboy14:
To be quite honest TCS, I don’t know why everyone has looked up to you, I thought you were a little too in… famous, to start with from what I’ve seen. And I knew that there was something a little bit wrong from the moment I saw it because, from what I have heard, you’ve overshadowed some of us when we took, uh, Brian Jackson down. Everyone hailed you as the person who took him down; (Peachy: Yeah.) yeah, I wish we could all take that back now.

Peachy:
Someone actually told me about that and said that they needed help, because TCS, they actually were, uh, one of the people who helped you guys with TCS- not TCS, with uh, BJ, and, uh, TCS took all the glory, and they wanted me to help them with that, and I said, “Okay, I’ll dig into it.” So it’s funny that you mention that because now, I have some more… evidence, uh, to back that claim up that someone else made.

Other people in the SplatSource community use the hashtag to go against Brian, and it even spread to Japan.
(The #EndBrianJackson Problem Google Doc)
(No direct link/archive because deleted)

Ellie's Tweet
L/A (Tweet with screenshot has been deleted)

PT4051's Tweet
25.1 tzelda_blaminghotaru.jpeg
L/A

(The #EndBrianJackson Problem Google Doc)
Only Desiree’s tweet (A) survived as of writing this

12
1/A
2/A

On the same day the hashtag went out, Brian Jackson II decided to announce his “retirement” from the Splatoon GMOD community.
PreserveTube
0:29, 0:52, 1:03, 2:18, 2:37
  • Lost everything due to mistakes
  • Going to leave to avoid things getting worse
  • Above 2 reasons is why he is leaving Splatoon community
  • Longer he stays, worse things will happen
  • All he ever does is lash out and throw tantrums
  • If only he behaved and kept calm, none of this would have happened
  • Repeats that he is leaving Splatoon GMOD community, says he is never coming back
  • Splatoon community too toxic for him, no one wants him anymore
  • Let everyone down and failed them
  • Repeats again he is retiring
  • Says not to cry for him, as he is already dead, and needs to move on

The very next day, Brian’s “brothers” made a YouTube Community Post, supposedly saying that Brian committed suicide. Skylar Karategirl also made an announcement on her Discord server saying that Brian committed suicide. A day later, the Brian Jackson II channel was wiped of all of its videos (though oddly not Brian’s two other channels).
(Talk with Texan: Brian Jackson II, 11:25)(The Mandatory Brian Jackson II Video, 3:32)

Flying Scott (text-to-speech):
Then, one day later, the YouTube channel is gone. Deleted, wiped off the face of the Earth. Oh, so his siblings took it upon themselves to delete the page, because it reminded them of their dead brother. That is all fine and all, but why is his second and third account still up?

And of course, the SplatSource community had to mourn the “loss” of Brian Jackson II. This also seems to have been when a Google Doc (titled, "The #EndBrianJackson Problem | Splatoon Gmod/SFM Community Becoming More Toxic", A PDF of the Google Doc should be attached to this post) was made, calling out TCS for essentially witch-hunting Brian.
(Brian_Jackson.exe, 7:09)

There are some problems with the announcement. First, it was written like Brian wrote it. Second, said “brothers” went into the comment section of the Community Post to reply to comments, and it wasn’t even consistent if it’s one brother speaking or multiple. However, the most damning part is that Brian has said he was an only child before, and doesn’t list any brothers on his supposed personal Facebook.
(The Mandatory Brian Jackson II Video, 1:23)(The Mandatory Brian Jackson II Video, 1:15)(The Mandatory Brian Jackson II Video, 3:10)(The Mandatory Brian Jackson II Video, 3:15)

With him not actually being dead, Brian returned in September 2019 under the name TheMysticBlaziken. This name didn’t last long, as in June 2020 he was exposed by TehCanadianSpartan and Loona65, forcing him to upload an apology, reopen his YouTube channel, and “return” to the community before retiring again in 2021.
(Brian Jackson II’s Splanimations Archives article)

Joxic:
However, the story doesn’t end there. As I mentioned, Brian’s two attempts were both foiled, like Team Rocket trying to get Pikachu for 20 years, by both TCS and Loona, which got a lot of criticism and hate towards it.
PreserveTube
  • No fire alarm chirps at all
  • Brian Jackson II is back and alive, reopened his YouTube channel
  • Has been “axed” to come back to explain himself
  • Says he is sorry for faking his death, says it was wrong
    • Did that because he was suffering from severe depression after people started dissociating from him
  • Really did feel like he wanted to kill himself, parents literally smacked him out of it and made him go to therapy
  • Dad made him go to church, helped but didn’t fully fix him
    • Had to go to many therapy sessions to talk about his traumas
  • Hurt his fanbase, his friends
  • Knows people will think what he is saying is “bullshit and lies,” says it’s not and swears he is not the person he was before
  • Talks about his mistakes and is sorry for them
  • Accepts what he did, and the consequences
  • All he had to do was not give in to his anger, will ignore and block people who give him trouble
  • Directly apologizes to Rudy
  • Is okay if people don’t like or criticize his videos
  • Calls his videos “comic dubs” and are not animations
  • Managed to win back friends he hurt and improve on both his behavior and his work
    • Made amends with Rudy
  • Hopes people can forgive him, as he is a changed person who will not repeat the behaviors of his past
  • Tells his fanatics to stop calling him their “Lord and Savior”
  • Promises to make the community better
  • Says he is truly sorry for what he did in 2019, as it was a bad year for him
  • Hopes people can forgive him
  • Typical YouTuber outro

As you may expect, most of this was a lie and he returned back to his old ways, causing some more drama. However, I will stop here as it’s not that relevant to the other stories here.

Geofcraze634​
(Geofcraze634's Splanimations Archive article)

During Brian Jackson II’s time as “TheMysticBlaziken”, sometime in late August 2019 (based on when Flying Scott covered it), relatively-large SM64 machinima-maker and SplatSource animator Geofcraze634 had his 2018 DMs leaked, showing him getting feet pics from the then-14-year-old Namisina46 and the then-17 year old Ellie Godelia (yes, the same girl who exposed Heavy the Squid for his ERP, sending feet pics in the aftermath of the Heavy drama).
His DMs with Namisina46:
(An Excavation Of The Largest Scandal, 7:50)(An Excavation Of The Largest Scandal, 8:43)(An Excavation Of The Largest Scandal, 9:52)(An Excavation Of The Largest Scandal, 10:30

Namisina46 told him that she was 14, yet Geofcraze634 still asked for feet pics and sent her foot fetish SFM posters with her OC.
(To Catch a Squidette, 15:39)(The Lewd House Continues, 0:47)
Geofcraze634:
Woah, you are actually 14, huh?

Namisina46:
yea…

Geofcraze634:
Hey, there is no need to keep a secret about your age. Everyone does (unreadable) age.

Namisina46:
Well… I honestly kinda (unreadable) it.
I fake my age cuz I dont want to be treated like a child
The fact is that I act older than my age and dont want to stick around with the annoying children

A DM made before Geofcraze634 was exposed (sent to someone who had his DMs leak later) confirms Namisina46 consistently lies about her age.
(TehCanadianSpartan Two Dropbox\TCS’ Weird DMs/Namisina46 (Minor)\Full Chatlog [NSFW])

12345
(TehCanadianSpartan.exe, 26:00-26:17)

I’m not sure when or to whom this DM was sent to (possibly to Namisina46), but ever since Ellie’s Downfall PART 1, it was public knowledge that Ellie and Geofcraze634 were close and RPed with each other.
(An Excavation Of The Largest Scandal, 7:00)

What wasn’t made public until now was the extent of the RP:
(An Excavation Of The Largest Scandal, 10:59)(Ellie Godelia’s Downfall PART 3, 5:43)(Ellie Godelia’s Downfall PART 3, 5:46)(An Excavation Of The Largest Scandal, 12:16)(An Excavation Of The Largest Scandal, 12:16)(Ellie Godelia’s Downfall PART 3, 5:49)








(To Catch a Squidette, 15:16-15:29)
(To Catch a Squidette, 15:34)(To Catch a Squidette, 15:36)

Ellie may have been cozying up to Geofcraze634 so that he could make her more popular, as she had been interacting with him since around 2015.
(To Catch a Squidette, 16:18)(To Catch a Squidette, 16:21)

When the DMs with Namisina46 were leaked, an individual named Moka confronted Geofcraze634, getting him to admit that he jerked off to the feet pictures.

(An Excavation Of The Largest Scandal, 14:02-16:27)

Publicly, Geofcraze634 made an apology (which has since been deleted) on a YouTube Community Post. Privately, he got mad at Namisina46 and ended up yelling at her in a voice call.
(An Excavation Of The Largest Scandal, 18:41)(To Catch A Squidette, 15:49)

Even after Geofcraze634's fetish for underage feet was exposed, Ellie still supported him as she claimed that he made her feel appreciated, and comforted her during a “depressive phase.”

Peachy:
I heard with the- I heard with the Geof pedophile situation, you, uh... still retweeted his stuff and still supported him afterwards. Is that true?

Ellie:
Yes, but I don't do that anymore.

Peachy:
What the fuck?

Ellie:
It's mainly because... I... (sighs) I needed some space to think, and... (sigh) I guess the real reason why I was friends with him... I'm not trying to sound like a pity- like make this a pity story or anything, but I'm gonna tell you the truth when I say this: he actually made me feel appreciated and...

Peachy:
Who, Geof or, uh, TCS?

Ellie:
Yeah, Geof.

Ellie:
But, regardless, I still considered Geof as a close friend, and… I think it was because well, he was there for me… when I was in my depressive phase. Like, I’ll- I’ll literally just call this whole… saga with me right now my “depressive phase.” And he was there for me to comfort me and, yeah he… he was just… he was there for me when no one else was there for me. I mean there was a few others i could name, but-

Delta225:
Well, he- he did- he did more than comfort you, though. He-

Pineapple:
Yeah, no.

Ellie:
Oh yeah, obviously.

Delta225:
To put it- to put it- to put it- to put it bluntly, he… yanked his snake to pictures of your feet.

In the same interview above, Ellie claimed she didn’t expose Geofcraze634 then because the timing (right after exposing Heavy) would have given her a reputation as a decoy girl meant to set predators up, which is something she didn’t want.

Ellie:
Through another person’s perspective, I think it was because I was afraid, “Oh wait, I just got out- out exposing Heavy, what if I expose Geof? They’re probably gonna think I’m doing this on purpose like I’m one of those…” uh… you know like those girls on, uh, Chris Hanson’s “To How To Catch a Predator,” like they hire overage girls, and you know, they disguise themselves as predators? (Pineapple: Yeah.) They’re probably gonna think I’m one of those people and- at that time, I didn’t wanna-

Pineapple:
Well, what’s the- what is the- what is- what is the problem with that perception?

Ellie:
I didn’t, because-

Delta225:
It- it- there’s really not a whole lot of problems with that. I mean we-

Ellie:
I mean, I guess because I didn’t want to get negative press and, literally, I didn't care about… I like, I just was not thinking straight and I just didn’t want to deal with all that heat on my back, so I just turned to Geof. But, looking back on it now, I SHOULD’VE taken that opportunity, and I’m… mad at myself that I didn’t.

In Ellie Godelia’s Downfall PART 2, crueldude100 speculated that Geofcraze634 ERPed with Ellie Godelia but didn’t have any proof at the time; it’s quite interesting that “now” there was hard proof of inappropriate behavior between Geofcraze634 and the then-17 Ellie (which kind of undermines her exposé of Heavy). Also, Ellie (unintentionally or not) reflects the general SplatSource community’s fear of being “mean” getting in the way of doing the right thing, even towards some of the biggest members of the community.
 

Attachments

Last edited:
TehCanadianSpartan & Peachy​
(CyndaFan TCS Tweet 1)

For some background, TehCanadianSpartan was encouraged by his friends and the people in TZelda’s server (a little odd considering past drama) to get with someone named Kaylanime, who he daydreamed about being romanticalled involved with.
tcsbeingencouragedbycreeps1.pngtcsbeingencouragedbycreeps2.pngtcsbeingencouragedbycreeps3.png
(TheCanadianSpartan Dropbox\Kaylanime Incident folder)

As a sign of things to come, TCS started to daydream about being with her. However, Kaylanime only wanted to be friends with TCS, so when she was informed (likely by Ishi) of TCS’s intentions, she pre-emptively rejected TCS. This friendzoning is basically why the titular “Peachy” gets involved.
tcsshadyshit.pngjobisdone1.jpgkaylantellsTCStostop.jpgitsover.jpg
(TheCanadianSpartan Dropbox\Kaylanime Incident folder)

And another thing:
Yes, this is the same Moka that exposed Geofcraze634, as confirmed by Flying Scott.

Flying Scott:
Or better yet, how about we take Moka’s word for it? You know, the girl who exposed Geof for being a filthy nonce?

Moka was supposedly gender-confused during this time, so everyone uses different pronouns to refer to Moka. I will refer to Moka as a girl because throughout the audio calls and in other videos, people refer to Moka as a girl before correcting themselves.

Peachy:
Get Laila, er, Mika in- let’s, let’s call ‘em Laila, and we’re gonna call, Moka “Moka,” because Mika and Moka sound the same, and that’s-

Guy in group call:
Wait wait wait, is Mika like a fuckin’ tranny or something?

Peachy:
What? No, Moka- well, Moka’s… uh, gender-confused, at least from what I heard.

Guy:
Ge-gender-confused? Oh, so that’s what we’re calling them now.

After the Kaylanime fiasco, a Splatoon-fan trolling group (misattributed as the Anti-Inkling Group) hired an 18-year-old to pretend to be “Peachy” (an innocent 19/18 year-old girl who wanted to be TCS’s girlfriend) to troll him right after being friend-zoned. You may have heard that Peachy lied about her age and said she was 16 (possibly from my initial post on this, oops) but this is not true; TCS misheard Peachy while Peachy was accusing TCS of something else and spread that around initially.
(TheCanadianSpartan Dropbox\TCS's fans witchhunting/tcsdeviantartfanwitchhuntattempt.png)

(Talking about who to add to DM group to get Zeldaboy’s opinion on TCS)
Peachy:
Uh, what about Ishi? Does Ishi need to be in?

Blazin:
Yeah, of course, of course!

Discord Guy: (underneath chatter of everyone else) Yes, he's the leader of this-

(Talking about who people thought revealed stuff about TCS, I’m interpreting this to also include who was behind the trolling plan)
Ishi:
Wasn't it Rudy that fuckin' said- no it was Rudy that said, fucking, AntiInkling did that shit, when it was clearly us- it was clearly, it has us written all over it!

Peachy:
At first, I thought it was just gonna be some idiot in the Splatoon community who’s probably just desperate for a girlfriend, like they all are, let's be- let’s be real here. All the guys in the Splatoon community are mostly desperate for... a partner!

Peachy:
He misheard that as, “I’m 16 years old.” I’m not 16. (Zeldaboy14: Ohh…) I said I was… 19 at first. In the middle of the trolling, or whatever you want to call it, I said I was 18, which I am actually 18, I said I was 18 to seem a little bit more innocent, a little bit. That was a little bit of a tweak on my end, cause I did feel a little bit bad, about saying I was 19 when really I was 18.

-heck, Jesus, what? You came in here, you came into a server, with someone who literally gets paid to troll people, to get evidence on them, and you’re saying all this shit like I really care. Like, do I genuinely care? Bitch, I’m getting paid, I don’t care.

This group might have been the Seven Deadly Boomers, based on a later DM leak where these people were talking about “ishi’s group.”
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Mass reporting saga\Full Chatlogs\Direct Messages - Broadside, Noctis Axton Aurora, TrueLegendary, JackInkling, JaXson [642440737874771983].html)

To actually start, Peachy goes to TCS’s DMs to ask if he’s looking for a girlfriend, being introduced to him by Moka (who initially wasn’t part of the trolling plan.
(TheCanadianSpartan Dropbox\Peachy Incident\goodlord.png)(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Continuation of Lewd House\Aknowledging minors\Hush_Hush.png(TheCanadianSpartan Dropbox\TCS LOGS\Direct Messages - Carson’s penis cam. [609832333746634773] [3 of 4].html)

Peachy:
And I think one of the main people you need to apologize to is Moka. Even though I’ve been shitting on them a lot and laughing at their failures, they have done barely anything… wrong. Matter of- even though they thought I was a real person, they have been a good friend to me- well, good friend to Peachy, at least.

Anyways, of course TCS accepts, and on July 26 2019, tells the world (according to the Splanimations Archive, A).
(Splanimations Archive article on 2019)(TheCanadianSpartan\Peachy Incident\tcseasilyfallingforit.jpg)(TheCanadianSpartan\Peachy Incident\imofficiallydeadpleasesendhelp.png)(TheCanadianSpartan\Peachy Incident\tcsnewsreachcommunitytab.png)(TheCanadianSpartan\Peachy Incident\tcsupdatedtwitterbio.png)
(Last 3 images are from TheCanadianSpartan Dropbox\Peachy Incident folder)

This announcement apparently caused some of TCS’s >50K subscribers (which he bragged about to her) to threaten to kill Peachy if she ever broke up with him. TCS also liked to show off Peachy to his fans, but went crazy if his fans complimented Peachy. It was because of these fans that Peachy felt pressured to continue the relationship, even though she could drop out at any time.

Peachy:
He said on the first day, “I have over 60 thousand-” not 60 thousand, “50 thousand subscribers.” And I was like, “Really, oh my gosh, I don’t even know who you are!” ‘cept his channel, I already knew who he was, by the- the way, beginning of the relationship I already knew who he was. That was his main point. Bragging about his channel, showing me his channel, saying “Yeah, hopefully we can get together one day and maybe we can share this together.” And obviously he posted videos of me, posts of me, and sharing me around.

His fans were pretty awful too, sending me thr- death threats in the beginning of the relationship, right when we got together, saying, “If you break up, I’m gonna kill you, I’m gonna come to your house,” um, all this kind of shit. And, he used me as an object, saying, “Yeah, this is my girl,” and anytime his… fans would say it, or say, “Peachy, you’re beautiful,” he would get fucking… at them. Which, you know, I had to play it the whole, you know, girlfriend who’s sticking up with his- with her… boyfriend, which I was like, “Yeah, don’t call me beautiful,” and all this shit. Like, uh, I think I did a pretty good job with that, honest-

Blazin:
I just want to ask you Peachy, did you ever feel like you were being forced into, like, even though you’re an actor and we did tell you to become- a rel- into a relationship, did you ever feel like- couldn’t back out of the relationship, like there was social pressure holding you into that relationship, like-

Peachy:
I did, that’s why-

Blazin:
If you ended up breaking up with TCS, you have had- (Peachy: That’s-) the outcome would have been the same, because even if you just broke up peacefully, and would you feel like he would’ve gotten salty? (Peachy: Ye-) You think his fans would have witch hunted you?

Peachy:
Yes, I still feel that way.

Like the other e-relationships in this community, it quickly turned sexual. Not only was there ERP, but TCS also sent Peachy unsolicited dick pics and apparently nudes, according to his (now-deleted) apology video.
tcsdoingwhat.jpgtcsdoingwhat2.jpgtcsdoingwhat3.jpgtcsdoingwhat4.jpgtcsdoingwhat5.jpgtcsdoingwhat6.jpgtcsdoingwhat7.jpgtcsdoingwhat8.jpgPhoto 06-09-2019, 18 30 35.jpgtcsdickpickpeachypov.png
(TheCanadianSpartan Dropbox\Peachy Incident folder)

TehCanadianSpartan:
As time passed, Peachy started sending nudes. But then I… sent one of myself.

Bad move.

The lewdness wasn’t limited to RP; TCS had made NSFW Splatoon GMOD posters of his and Peachy’s characters. While it was private initially, TCS soon made an NSFW Twitter account to publicly post these pictures, and even announced it to his fans! :stress:
HOLDUP.pngtcsdoingweirdshitingmod.pngTCSnsfwshit.pngtcsnsfwshittweet.pngtcsnsfwaccounttweet.png
(TheCanadianSpartan Dropbox\Peachy Incident folder)

With how lewd TCS got after getting with Peachy, some wondered if that was Peachy’s fault. However, not only did he admit to masturbating and watching “plenty of porn” to Peachy, but he supposedly jerked off while making a scene for one of his Garry’s Mod videos! When this is later brought up again, Blazin and Peachy say it’s supposed to be in the “Peachy Incident” folder of the Dropbox, but it doesn’t seem to be there anymore.

Zeldaboy14:
Okay, so… You know, I kept hearing stories, um… something about that TCS wasn’t lewd before- ‘fore he met Peachy, is that true or is this false?

TCS:
It is- (Peachy: That’s a lie.) it is a- it is a hundred percent true, because actually (Peachy: It’s a lie.) I’ve never done it before. Listen to me, (Peachy: It’s a lie. Shh!) I’ve actually admitted it, I have not ev- I’ve- listen, I am dead serious-

Peachy:
No, no no no no no no. No, no no no no no no no.

TCS:
Yeah yeah yeah yeah yeah!

Peachy:
TCS had told me- TCS had told me he has masturbated before, and he’s watched plenty (TCS: Yeah, but it’s been a very long time!) of porn, and- and- AND! He even told me, TCS, I swear if you lie on this one, you said when you were making that bikini scene in that one GMOD video, you were jerking off!

TCS:
Actually, no I wasn’t.

Peachy:
You said you were.

TCS: No.

Peachy:
I had a screenshot and I sent it to Ishi. You said you were. You said you were playing with yourself while you were doing that.

Blazin:
I mean you can’t deny the facts.

Peachy:
While you were looking at… it. It’s hard to deny the facts.

TCS:
I still have your DMs, let me see if I can find it.

Peachy:
You even said yourself, you even said yourself that you watched porn before. (TCS: Yeah, but it’s been a very long time-) But you stopped-

Blazin:
I mean, he’s a man, he gets to watch porn, but the point is he wanks off to his own content.

Peachy:
Yeah, he jerks off to his own content, he WAS lewd before he met me. But it seems like I “forced” him into the light or some crap like that. More like you feel more confident to be… lewd and disgusting because you have a girl… friend.

TCS:
I’m gonna do it-

Discord Guy 1:
TCS, TC, I have one more question; is it true you fapped to the beach scene?

TCS:
Okay, so about that. No I didn’t. (Peachy: That’s the scene I was talking about.) No, I didn’t, because, looking at that, I didn’t even find it sexual! (Peachy: Ah!)

Blazin:
It does have sexual connotations.

TCS:
It was more- it was more like-

Peachy:
That’s a lie. That’s a lie, that’s a lie, Ishi can back that up.

TCS:
Can you pull up some screenshots?

Peachy:
Ishi! Ishi, send the photo! (TCS: Please pu-) Send the screenshot!

TCS:
Please… (Discord Guy 2: Do it Ishi!) please.

Peachy:
Send the screenshot!

TCS:
Please, I need to know for myself ‘cause I don’t even remember.

Peachy:
Oh, oh, now you’re playing- (Discord Guy 1: You don’t remember?) the “don’t remember” card?

TCS:
Just pull up the screenshot! I want to know if I actually said it.

Peachy:
Ishi’s the one that (Discord Guy 2 (quietly singing): Why you fuckin’ lying?) has all this shit saved. Too much info, there was- it- there was too much info. Look up “beach scene” in your computer, or something, I don’t know.

Blazin:
Just see through it.

TCS:
Is this from like, the series I made, or is it (Discord Guy 1: Yes!) something else?

Peachy:
Yes, yes!

Blazin:
DFTO, or whatever it’s called.

Peachy:
The one girl, the, uh, Agent 8 girl, (TCS: Yeah.) in the bikini scene, you said you were jerking off while making it.

Discord Guy 1:
Mate, they don’t even have like ti-

Blazin:
Kinda weird bruh.

Peachy:
That’s a- that’s a- that’s a bad-

TCS:
Please, I need to know if it actually exists or not.

Peachy:
Well, let Ishi figure where it is, ‘cause there’s so many screenshots (Zeldaboy14: I’m looking in the Dropbox.) of you fucking up. Yeah, look in the Dropbox for us, thank you.

Blazin:
I’ll look through the Dropbox too.

Zeldaboy14:
I don’t see anything so far.

Peachy:
Maybe Ishi just has it in his own computer, I don’t know. But-

TCS:
Oh wait a minute, hold on, hold on… Hold on, let me look at it because I think I remember something.

Zeldaboy14 (seems to have found HOLDUP.png):
I found this, that might be a bit of- er, wait, yeah, okay it shows.

Peachy:
Let’s see, let’s see, let’s see.

TCS:
Lemme see.

Zeldaboy14:
This is something different than what you’re talking about, but-

Peachy:
No, that’s something different. It’s a bikini scene, but-

Zeldaboy14:
Yeah, but I thought I might as well bring it up.

TCS:
Hold on… (Peachy: That isn’t it, chief.) hold on, let me find it, um… somewhere around here… it has to be. I’m looking in “Peachy Incident,” is it supposed to be in there?

Blazin:
Yeah.

Peachy:
Uh, yes.

I believe they are talking about TCS supposedly jerking off to this scene. Apologies for the reaction video, TCS nuked his channel so this is the only way besides a worse-quality reaction video (PreserveTube) to still see this.

(Reaction To [Splatoon GMOD] D.L.O.T.A Episode 2 (PreserveTube), 11:11)
Apologies for the reaction video, but this was the best "reupload" that I could find, since I couldn't find the original.

TCS also spent a lot of money on Discord Nitro (in total around $400) for Peachy, holding that over her head to make her continue to interact with him and keep her in the relationship during an argument over Skylar Karategirl e-”squishing” TCS.

Peachy:
In, uh, uh, TZelda's server, you know that one girl who's like 32 or something, I said in that server, in the venting server- in the venting section of the server, I said, "I wish I had Nitro. I hate this account." Which was, you know, just to play off the whole entire role of, you know, the- the "18-year-old girl who's just getting out on her own and has no parents," you know... stuff like that. And he bought it for me, and gifted it to me, when I didn't even ask... him to. And he kept it over and over, every single time when I... rung up like my friends, or like my sister, he-... like, a fake sister, by the way, he would keep buying me things for these… people, which they never claimed. They never- ‘cause they didn’t exist. Cause I was faking it, to play it off. And he would buy, send it to me, and I would like, “Oh thank you, but the link isn’t working.” But, I just decided it, to claim the Nitro on this account, so like I could have the profile picture as a gift that he wanted me to do or some retarded shit, but anyway.
tcsthrowingawaymoney1.jpgtcsthrowingawaymoney2.pngtcsthrowingawaymoney3.pngtcsthrowingawaymoney4.jpg31.1 whatevenisthisexcusemewhat.pngTCSweirdcuddleshit1.jpg
TCSweirdcuddleshit2.jpgTCSweirdcuddleshit3.jpgTCSweirdcuddleshit4.jpgTCSweirdcuddleshit5.jpg
31.7 TCSweirdcuddleshit6.jpg(TCS is lying to you Dropbox, Screenshot_20190909-082431.jpg)
(All above screenshots except the last from TheCanadianSpartan Dropbox\Peachy Incident folder)

Peachy was getting sick of keeping up the fake girlfriend act, so she said she would “go to the mental hospital” to get some time away from him. When she first brought it up, TCS asked if there was Internet in there, so he could continue their ERP sessions.

Peachy:
I remember this one time he even asked me on the- this one time he even asked me on the phone, if wh- if whenever I go into a men-... That was when I took a break because I didn’t wanna be around him for a while because he- he absolutely disgusted me. I remember this one time, we were on the phone and I said, “I may enroll myself in a mental hospital.” He said, “in the mental hospital, do you have… Internet? Because I probably wanna see some lewd stuff in there.”

Eventually, TCS’s behavior (asking for nudes that Peachy supplied from elsewhere, asking for her phone number, and asking for her address) disgusted Peachy so much she went through with the “mental hospital” plan. TCS then used this to gain sympathy publicly, while privately asking Moka to get Peachy’s address (who gave a fake one given by Peachy) and sent over a dildo for Peachy for when she got out of the mental hospital to go with the fleshlight he bought.

Peachy:
He would @ me for nudes, which obviously weren't mine, I would get them off of Google, or like a different server or something, and he would send me unsolicited dick pics and shit like that. Ask for my phone number everyday, ask for my address, and at a certain point... he asked Moka, which I'll get into that person soon, for my address and my phone number. Which they didn't give my... phone number, they gave to him "my" address, because I gave it to them earlier, as like a ruse because I knew he was gonna do something like this. Which I'll get into- in a second. (sighs)

So after, all of that, I- we obviously went into a group chat when- oh wait, hold on- So, he asked Moka, for... my address, which they gave it to him, because he was pretty forceful, saying, "Okay I'm gonna buy myself a fleshlight there and I'm gonna buy Peachy a dildo!" So that's what he did.

Blazin:
Eugh! For fuckin' hell, okay!

Peachy:
Yep, and I was in a "mental hospital," quote-unquote, but really... really, I was offline and I wasn't on this account because he made me sick and I got tired of all of the sexual comments every 5 seconds. So that's where I was, I wasn't- I wasn't in the mental hospital but I said I was. Cause I wanted to see what he did, and he used me being in a mental hospital as a way to get sympathy. And he sent a dildo to this fake address that- that I gave Moka, to give him, and... surprise surprise, he sent a dildo to- his girlfriend's house, after she gets out of the mental hospital.

If you’re thinking that was too ridiculous to be true, TCS sent proof of him buying and sending the dildo to some random address. This was apparently a joke by Moka that TCS autistically took literally.
Photo 07-09-2019, 00 38 47.jpgPhoto 07-09-2019, 00 38 41.jpg
(TheCanadianSpartan Dropbox\TCS dildo delivery folder)

TCS:
Moka jokingly said that I should buy a dildo for Peachy. I thought he was serious.

Knowing (what he thought was) her address, TCS even wanted to go to Peachy’s house at one point.

Peachy:
Hold on, let me tell you this next thing. He actually told Moka that he was thinking about coming to my HOUSE. ‘Cause he saved the address.

While the above is pretty degenerate, it was at least between adults. However, it wouldn’t be SplatSource drama unless there were minors involved; TCS talked about the lewd stuff (including sending what he thought was Peachy’s nudes and talking about masturbation and sex toys) in a group chat with minors, some as young as 13-14. While he didn’t know the ages of most of them, he did know that Moka was 16, but continued because she “sounded fi
Photo 10-09-2019, 21 19 19.jpgPhoto 10-09-2019, 21 19 25.jpgPhoto 10-09-2019, 21 19 30.jpgPhoto 10-09-2019, 21 19 35.jpgPhoto 10-09-2019, 21 19 40.jpg
(TheCanadianSpartan Dropbox\moka and tcs folder)

Peachy:
We all found out that he was actually sending "my" nudes- you know, "my" nudes, my fake ones that I got from online, but he sent the nudes he thought was mine, talking about his dick, and talking about phone sex between me- and… me and him.

Blazin:
Wait, he shared "your," right, quote-unquote "your" nudes to his mates?

Peachy:
Yeah, yeah, it's in the- it's in the Google Drive, it's in the screenshots, he did that!

Blazin:
That is (Peachy: And he- and he confirmed to it!) absolutely disgusting! Oh my God, that's horrible!

Peachy:
Yeah, to a six- to a 16-year-old! To a person he knows is 16 years old! And his first excuse before confirming it, he said, "You looked comfortable with it."

Blazin:
Um…

Peachy:
And you said- and you both confirmed that you talked about your penis to them, talked about our phone sex, you talked about- you sent them my nudes in private DMs, you asked them - at least from what I heard - how they masturbate and what kind of sex toys they use.

Zeldaboy14:
Where are you getting this?

Blazin:
Is that true?

Peachy:
How ‘bout you- did- can you confirm that for us? Did you ask them what kind of sex toys did they use and how did they use them?

TCS:
No, that’s not- that- like I can confirm that, that I never asked.

Peachy:
So, you never asked them for a website to get a dildo for me, and you didn’t ask them what kind of dildos and what kind of sex toys they buy?

TCS:
Actually, the thing is, Mok- like, I don’t remember it entirely, but Moka got me to the website, and I didn’t even, like… Moka, like-

Peachy:
Yeah, I can already smell the bullshit on this- [...]
Photo 08-09-2019, 21 58 05.jpgPhoto 08-09-2019, 21 58 10.jpgPhoto 08-09-2019, 21 58 14.jpgPhoto 08-09-2019, 21 58 19.jpgPhoto 08-09-2019, 21 58 24.jpgPhoto 08-09-2019, 21 58 29.jpgPhoto 08-09-2019, 21 58 34.jpg
(TheCanadianSpartan Dropbox\moka and tcs folder)

Moka:
Basically, as you guys know, TCS, or our little Canadian friend, has had a little bit of a problem not sharing around his relationship and his sex life, and other sexual aspects you should not talk about to minors, to well, minors! Me, for example, Plormby and Laila, two people who are sticking up to him, most likely for attention and for fame, which I will not do, because in other communities I have plenty of attention and plenty of recognition.

TCS has sent me plenty of porn that he has created, and his girlfriend’s nudes for matter of fact. And in a group chat, he sent MINORS in a group chat, Laila and her 13-year-old boyfriend, girlfriend, thing, and Plormby, who was like 15-16, I don’t fuckin know, all I know is that they’re all little kids. And TCS said himself that he, “didn’t know that Plormby and Laila were underage!” Ah- (sighs) Okay, but he knew I was underage and he couldn’t make an excuse for that because literally everyone was saying it 24/7.

While it doesn’t excuse him, the group chat dump included in the Dropbox and a line in the confrontation voice call does show that the group had a lot of sexual humor or “locker room talk.” TCS was very stupid to use that kind of humor while in the group chat, but I can see why he did that if he wanted to “fit in.” I’m also not sure why Peachy didn’t catch any flak for sometimes bringing up sex talk (even if it was part of the act), since she was an adult as well.
Guide:
mika! = Laila
Spoopy Ollie = Moka
Koa = Peachy
12
(TheCanadianSpartan Dropbox\TCS LOGS\Direct Messages - Carson’s penis cam. [609832333746634773] [1 of 4].html)
123456789
(TheCanadianSpartan Dropbox\TCS LOGS\Direct Messages - Carson’s penis cam. [609832333746634773] [2 of 4].html)
1234567891011121314
(TheCanadianSpartan Dropbox\TCS LOGS\Direct Messages - Carson’s penis cam. [609832333746634773] [3 of 4].html)
123456789
(TheCanadianSpartan Dropbox\TCS LOGS\Direct Messages - Carson’s penis cam. [609832333746634773] [4 of 4].html)
For some reason, Moka sent a picture of her “sister’s” dildo to TCS; when TCS brings this up to get a “win” on Moka, the picture gets treated like a trolling attempt.

Moka:
But, that doesn’t excuse you to fuckin’ be a fuckin’ creep, dude. Do you really think I want to-

TCS:
You own a dildo. You sent me a picture (Moka: Damn-) of your dildo.

Moka:
No I didn’t!

TCS:
Yeah you did.

Discord Guy 1:
I don’t believe that, TCS.

TCS:
I’ll pull it up!

Discord Guy 1:
Oh boy.

TCS:
I am dead serious, I have it. Don’t believe me? It’s gonna show up. Like I am done.

Discord Guy 1:
Oh really, you’re “done”?

TCS:
No, I’m done, but because this is- I have the picture.

Moka:
You saved the picture on your computer?

TCS:
No, it’s literally right there. Right (Discord Guy 2: Bruh moment.) under the text.

Moka:
Where? Wait, (TCS: Just scroll.) is it on camera?

TCS:
Yes, it’s on camera.

Moka:
Hold on, I don’t see anything, you don’t even have your- your camera on!

TCS:
There it is, found it.

Moka:
Where, let me see it.

TCS:
There it is, you sent- you sent me this.

Moka:
Oh yeah, I did send that! (laughs)

Discord Guy 1:
What the fuck?

Moka:
That’s not even mine, that’s my sister’s!

Discord Guy 1:
Oh boy, you got trolled, TCS.

Moka (cracking up):
That wasn’t- that was before I knew all of this shit, yeah that’s my sister’s, I had it on my shelf, and she couldn’t find it-

Discord Guy 1:
Wow, you fuckin’ fell for that one!

It’s also from Peachy that the Lewd House’s existence was known, as TCS tried to invite her to it. Plus, despite knowing she was underage, TCS tried to get Peachy to have ghostoftime1 invite Moka to the Lewd House.
(Lewd House Heist SFW Dropbox\TehCanadianSpartan\tcsinvitingpeachytolewdhouse.jpg)

Peachy:
And even knowing that he- he persuaded me to tell, uh, that one person - what’s his name - Ghostoftime, to get, uh, to get Moka, into that one sex server, that made me even more disgusted because he [TCS] knows that Moka is underage.

Peachy did at least get some trolling done, using her status as “TCS’s girlfriend” to damage a few of TCS’s friendships.
peachydamagingafewfriendships1.jpgpeachydamagingafewfriendships2.jpgpeachydamagingafewfriendships3.jpgpeachydamagingafewfriendships4.jpgpeachydamagingafewfriendships5.png
(TheCanadianSpartan Dropbox\Peachy Incident folder)

Peachy:
Doesn’t- that doesn’t solve anything, that doesn’t give us anything.

Ellie:
TCS, listen. You need to understand. Words can have consequences, words can sting. I should know because, I don’t think I told you this, but when Peachy told me to go fuck myself in that other server, you remember that Peachy?

Peachy:
Yeah, I remember that, I-

Ellie:
Like that actually stung, and it really hurt, and I was literally crying, like, for about 5 hours. And, I wanted to tell you so bad that she was- that Peachy was being rude to me, but I was afraid you were going to attack me, saying, “Peachy would never attack you, Peachy’s innocent!” I was afraid you were going to defend her. And… I was honestly afraid that you weren’t going to listen to reason. So I kept it quiet, and I- [...]

Eventually, Peachy drops the act (likely on September 6, 2019, based on that Peachy says she revealed herself on “Friday” and the “last modified” date of audio file in the Dropbox being September 10, 2019).

Peachy:
I’m pretty sure you… know that I was in Moka’s account - I believe it was Friday - when I revealed that I was a fake?
(TheCanadianSpartan Dropbox\Audios folder, can be seen if you copy the Dropbox to a personal account)

She invited TCS, Moka, and Laila to a group chat with the trolling group, revealing the truth. However, Peachy screwed up the reveal; while going into Moka’s account to try to destroy the server, Peachy (as “Moka”) messages Laila that she was Peachy, thinking she was part of the plan (Laila was in the group chat where Peachy revealed herself, she initially reported on TCS talking about lewd stuff to minors, and was going to be the next fake girlfriend) and that Moka was supposed to get the blame pinned on her.

Peachy:
Anyway, after all of that, we had the group chat, you know, revealed ourselves, then I went into Moka's account. Which, they didn't have two-step verification. I already checked this morning, they do have it now, which is- so I can't do that- did last time anymore, but anyway, I went into TCS's server, cause Moka was the one with, uh, admin power. I asked TCS for admin, and to be above everyone in the server, on that account, so... then I had access to add in a bot to raid the entire server. And that's what I did.

And I did do the mistake of DM'ing one of their friends, telling them that I was Peachy inside of Moka's account, because their friend was in the group chat with us when we were, um, revealing myself to... TCS, and listened to everything, so I thought she was on board to help me troll my next victim, but obviously she turned out to be a fucking rat, and now they're shifting blame onto this, uh, this girl, this 16-year-old girl, so uh- I can't do much about that, but, uh, that's a "my bad," I guess.

Peachy:
But, I was in Moka’s account then so I could hack into your… server and put the bot in there, so your server…

TCS:
Why would you do-

Peachy:
…destroy itself.

TCS:
Why would you do-

Peachy:
Because, because. We just wanted your server gone. We wanted to hurt you, more. (TCS: It- and-) We wanted to- we wanted to show that we were present, basically. And I messaged Laila, because Laila - or mika, is uh, I don’t know at this point, because you guys change your name so much, Moka changes their name so much, I don’t even know who they are anymore - but, I messaged her, because she was in the other group chat and she said in the call with us that she was thirteen year- years old, and you plotted with Moka to send a dildo to my house. And, uh, that you were talking sexual to her and she listened to you talking sexual with, uh, Moka, and she was basically the first one to make us aware of that.

So, I told her, along with everyone else in this group chat, that I was going to go on Moka’s account to get down your- break down your server because I didn’t have admin on your server for some reason. So I messaged her on that account, and I said, “You know what? This is actually Peachy in here, I’m going to get the server destroyed.” And I DMed you and asked you if I was moderator and to move my role all the way to the top, so I could get the bot to destroy the rest of the server and to ban everyone else under me. So that’s how that happened. Um, I don’t know about this entire idea of her saying she… was… uh, what’s this whole entire thing about her being- ‘bout to be your next fake girlfriend, you didn’t hold her accountable for that at all?

TCS:
I don’t hold her accountable, what?

Peachy:
But, I did do that, because I thought the plan was to, uh, blame it on Moka and wipe my hands of it. But no, the plan was to say “Peach didn’t exist,” [...]

Unfortunately for the trolling group, Laila decided to be a turncoat and sent a screenshot of Peachy in Moka’s account to TCS.

TCS:
Laila then led- later on, sent me a screenshot of Moka saying she was Peachy.

Also, while Peachy was explaining to TCS that he was talking about “her” nudes to a 16-year-old, TCS misheard her and thought she was saying she was 16.

TCS:
She then told me that I was talking about nudes to a 16-year-old. I misheard her and thought she was talking about her age being 16 instead of 18, when really, she was talking about Moka.

The Dropbox goes public on or before September 7, 2019 (based on the name of these Twitter DM screenshots), with the trolling group apparently also spreading his dick pics on Twitter.
Photo 07-09-2019, 19 43 19.jpgPhoto 07-09-2019, 19 43 39.jpgPhoto 07-09-2019, 19 43 46.jpg
(TheCanadianSpartan Dropbox\TCS’s fans witchhunting folder)

Peachy:
WE revealed all the information, and yeah, we were a little bit harsh, let’s admit it. We were a little bit harsh revealing your dick pics on Twitter and shit, no matter how funny it was.

TCS gets pissed, and sends his fans after everyone involved in the scheme and videos reporting on it. Some of his friends and fans also joined in sending people after everyone involved. Apparently TCS’s friends and fans were so block-happy, they didn’t even check if they were blocking the right Peachy :story:
attemptedmassreportonme.pngPhoto 08-09-2019, 09 40 32.jpgPhoto 08-09-2019, 21 32 20.jpgtcsskylarwitchhunting.pngtcsskylarwitchhunting2.pngPhoto 09-09-2019, 19 23 23.jpg
(TheCanadianSpartan Dropbox\TCS’s fans witchhunting folder)

TCS also put a lot of the blame on Moka, thinking she was Peachy at the time.
(TheCanadianSpartan Dropbox\moka and tcs folder\tcsblamingmoka.png)(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Boxie Server Staff Chatlog\Staff Chat.zip\Boxie Land and Pretzel Cabin - staff-chat [618024372921434113] [4 of 29].html)

In retaliation for Jacktropolis siding against TCS when the news broke, TCS also tried to break up the relationship between Jacktropolis and RudyOctoGamerVA.
(TCS is lying to you Dropbox\unknown-8.png)

Despite TCS saying not to “witch hunt” them, everyone involved got lots of harassment and death threats. Some were pretty funny (such as Peachy getting called a Nazi :story:) but others were more serious.

Peachy:
I just got another message, how uh- "Fuck you Peachy, you are a Nazi. You'll never get away with this."

Discord Guy 1:
How- how are you a Nazi? Hold up.

Discord Guy 2:
Bruh... 1978!

Peachy:
Because- because everyone was making a joke that TCS was a Jew because he has a long-

Discord Guy 3:
He’s even s- sent his fans to witch hunt us.

Blazin:
I have actually received… death threats upon death threats, including, um, Peachy over here. Ishi has received death threats, I have received death threats.

Peachy:
I have- someone sent me a GUN in DMs, and said “you better be scared of me.” I can s- I’m gonna send that in #general right now- (unintelligible)

Discord Guy 3:
Uh, check ‘em, we have him in the server right now.

Blazin:
It’s Woomy.

Peachy:
He’s still in the server.

Discord Guy 3:
Yeah, we have him in the-

Peachy:
Just… look- look in- look in, uh, faggot- #faggiedance-1. (Blazin, reading DM: You’re going to fucking die and not be take-) That’s what I got sent. That’s what I got- that’s what I got sent. For that.

Peachy:
Yeah, and (Blazin: for being a per-) also, mind you, you’re getting you fans to dogpile on top of them, which I, honestly I was a little bit sad that your-

Blazin:
You have publicly named and shamed all of us, and I’ve actually received - I’m a 14-year-old kid, right - and I’ve received… nearly about, what, 40 death threats from all of your different fans.

Photo 08-09-2019, 17 35 20.jpgPhoto 07-09-2019, 19 46 20.jpgPhoto 07-09-2019, 19 50 41.jpg
(TheCanadianSpartan Dropbox\TCS’s fans witchhunting folder)

Some of TCS’s fans tried to get Peachy’s nudes to use against her, which is odd because based on TCS’s word at the time, they likely thought she was the 16-year-old Moka.

Peachy:
I don’t know if you’ve heard this part, Ellie, or if Moka and your other mods have shared this around, but there has been certain fans, more than the one that I have actually shared, that have asked me for nudes. And I know they are going to use them as… you know, evidence against me. And since they think I’m a 16-year-old girl named Moka, that’s a little funny that they’re asking me for nudes. Cause (Blazin: Bruh.) that’s kind of child porn, if you think you’re getting nudes from a 16-year-old child.

Predictably, Moka got most of the hate due to TCS, which was so bad Moka cried for hours.

Peachy:
Ellie, can you confirm this? Is it true that last night Moka was crying, or something among the lines of that?

Ellie:
Yes, she was. She was- it was awful, like I literally woke up to crying and screaming and... um...

Blazin:
Moka is a young girl. You made a young girl cry and you're an adult male. (Discord Guy 1: Okay, I don’t really understand what’s going on with Moka, can someone explain?) Just think about that, let that sit in.

Ellie:
Like- hang on. And... she was like weeping, like I could literally hear her sniffling. She was- like, she sounded completely broken, like the "rough n' tough" girl I knew was literally a crying mess and... she literally had no idea what she did wrong and she feels she was used, and then... I... (sigh) I like, I literally tried to comprehend but my- but I was like- it was like 3 AM when this happened, so the last thing I remember was literally hearing her crying and then like I fell back asleep. Because I literally could not stay up, like I tried to stay up, for the sake of listening, but... I really didn't have enough energy. But...

Peachy:
Sorry, my internet fucked. Sorry, that's my bad.

Ellie:
It's alright. But yeah, I could still hear crying in my head. And... I've... wait, uh... oh wait, this wasn't at 3, this was at like 12'o'clock midnight.

Peachy:
Don’t worry, I’ve purged everything that happened from this server because Moka kinda spilled their guts last night to us. Uh, not really gonna blame them, because they were having a little bit of an emotional moment. I heard it was really… traumatic, especially with all those people DMing them, I can- I can understand.

Moka:
Like I said before, I don’t care.

Discord Guy 1:
I could care less, honestly.

Moka:
‘Cause I was crying way more than that, I was literally choking on my fuckin’ s- my fuckin’ spit last- [...]

TCS’s friends and fans had sided with him because the relationship was fake and Ellie Godelia made a video supporting TCS, and because of those two reasons they ignored/downplayed TCS’s behavior towards Peachy, Moka, and Moka’s friends.

Peachy:
Alright, this is the thing. If I was a real person, I’m sure that everyone in the Splatoon community would be crying at my feet, be saying, “You’re such a princess, it’s okay,” but since it was a fake relationship, everyone’s taking his side automatically because the only thing they see is “fake relationship.” They don’t see that TCS thought this was a real relationship and he treated his girlfriend like- and meant that her mental health was less important than his fucking sex dr-

Ellie:
If this is-

Peachy:
I suggest- I suggest making it publicly making it known you do not support him because people are gonna try to tag you in that kind of shit. Because honestly, when it first came out and you made that dumb video, everyone was saying, “Ellie believes him, so we all have to believe him now!”

After a few days, the trolling group opened up their Discord server to clear the air. Specifically, they talked to Ellie Godelia, who after listening to them, decided to delete her video supporting TCS.
(TehCanadianSpartan - Going Full Circle, 12:55)

Ellie:
It’s better for me not to choose a side, in fact, maybe I should just delete that video of my thoughts on the TCS situation (Discord Guy 1: You should.) cause-

Peachy:
Cause honestly, I think that- (Ellie: Why, there’s-) I think being neutral-

Discord Guy 1:
Drama is never good for the per-

Peachy:
Being neutral is sort of-

Ellie:
Yeah, let me just- let me just find the video so I can get rid of it.

After talking with Ellie, they then moved to a Discord group call to invite and talk to Zeldaboy14 and TCS himself.

Peachy:
Uh, you guys just make a group chat, and, uh, add Zeldaboy in, and we can start that up, right now.

Peachy:
Just tell TCS to get in here, come on dude! Yeah, speak like adults, get in the fucking voice chat. Alright, let’s see. (Someone joins) Hello-

Blazin:
Alright, remember to record the conversation.

Peachy:
Oh, he’s not even in here, is he?

Discord Guy 1:
No, he’s delaying.

Peachy:
(Sighs) Oh my goodness...

Discord Guy 1:
Yeah, he’s delaying.

Peachy:
“Sorry about this shit,” no, tell him to come in here, we’re not playing the pity game. (Blazin: He’s in, he’s in.) Hi, TCS.

During this call with the trolling group, TCS starts working on an apology video, and eventually makes a statement telling his fans to stop harassing the trolling group.

TCS:
I don’t like- I- I-

Blazin:
Well actually, here’s an idea, let me just speak for a second, right, right? Once you’re finished scripting, send us the script before you go ahead and upload, and we will just- we’ll run it by us, we’ll- we’ll see, okay, we’ll see. Like if there is anything that we think is false, we’ll talk to you about it, and we’ll run it through you again, and we’ll see what you’d want to change then, how about that?

TCS:
Alright, but it might have to take a couple of days to actually finish ‘cause I know it’s going to be very long.

Peachy:
Eh- no, no, I don’t trust that, I don’t trust that, it shouldn’t take a couple of days.

Blazin:
Yeah, but he will be running it through us, it’ll be a genuine (TCS: Yes.) apology, wouldn’t it?


Peachy:
We got a few seconds to, uh, breathe, until he comes back into the call, so take this break if you need it now-

TCS:
Alright, got it.

Peachy:
Alright, he’s here! Nevermind, he’s here! Alright, uh, ah-

TCS:
The announcement has been put out.

This seems to be the announcement, based on the timestamp.
(TCS is lying to you Dropbox, cropped from Screenshot_20190909-074459.jpg)

A few days after the call, TCS uploaded a video apology (which unfortunately does not seem to have been archived in its entirety, only in parts through videos talking about TCS) and seems to have made an apology announcement on his Discord. He would also apologize to Peachy and Moka on Twitter.
(TehCanadianSpartan - Going Full Circle, 7:42)(TehCanadianSpartan.exe, 17:38)(TehCanadianSpartan.exe, 21:38)

Based on this screenshot and the last-modified dates, the “TCS is lying to you” Dropbox was released sometime after TCS’s apologies. The Seven Deadly Boomers implied it was made by Rosa, one of TCS’s defenders during this drama (who got banned for bringing up the Peachy drama after TCS apologized and tried to move on).
(TCS is lying to you Dropbox\Screenshot_20190909-074459.jpg)(TCS is lying to you Dropbox)
Lewd House Heist SFW Dropbox\000 READ THIS.txt said:
btw nice Dropbox on us Rosa
Rosaban1.pngRosaban2.pngRosaban3.pngRosaban4.pngRosaban5.png
(TheCanadianSpartan Dropbox\TCS’s fans witchhunting\Rosa Incident folder)

While there are some anti-TCS screenshots, the majority of the screenshots are simply the trolling group using slurs and being edgy, probably in an attempt to discredit the trolling group’s accusations and justify the harassment against them.
Screenshot_20190909-074628.jpgScreenshot_20190909-074701.jpgScreenshot_20190909-074731.jpgScreenshot_20190909-075636.jpgScreenshot_20190909-075655.jpgScreenshot_20190909-080213.jpgScreenshot_20190909-080715.jpgScreenshot_20190909-081015.jpgScreenshot_20190909-081151.jpgScreenshot_20190909-081324.jpgScreenshot_20190909-081609.pngScreenshot_20190909-81627.jpgScreenshot_20190909-081805.pngScreenshot_20190909081949.jpgScreenshot_20190909-082222.jpgScreenshot_20190909-082346.jpgScreenshot_20190909-082401.jpgScreenshot_20190909-082546.pngScreenshot_20190909-82624.jpg
(TCS is lying to you Dropbox)
Anyways, Moka then makes a comment on the video pointing out how TCS shouldn’t be forgiven because of him talking about sexual stuff to minors, which TCS simply brushes off. TCS then suddenly started to rant about her on Twitter, along with supporting Laila (mika) and her partner Izu! (two minors in the group chat TCS talked about sex stuff but were against Moka) and claiming he both didn’t “sexually abuse” anyone and just lied to get the heat off of him
(TehCanadianSpartan.exe, 47:12)(TehCanadianSpartan.exe, 47:26)
tcsmokatwitterrant1.pngtcsmokatwitterrant2.pngtcsmokatwitterrant3.pngtcsmokatwitterrant4.png tcsmokatwitterrant5.pngtcsmokatwitterrant6.pngtcsmokatwitterrant7.pngtcsmokatwitterrant8.pngtcsmokatwitterrant9.pngtcsmokatwitterrant10.pngtcsmokatwitterrant11.pngtcsmokatwitterrant12.pngtcssupportingmokaharassment.png
(TheCanadianSpartan Dropbox\moka and tcs folder)
 

Attachments

Last edited:
Now, it seems like TCS wasn’t really sorry and was only concerned about his reputation, which was exemplified by how he dealt with SplatSource drama-tubers. When Peachy initially brought up Flying Scott to TCS, not only did TCS start to worry about Flying Scott making a video on him, but he started to blame him for everything, including accusing him of being Peachy! :story:

Peachy:
Also, I forgot to mention that, uh, Flying Scott, a person that, you know, has made multiple videos, even on you, Ellie Godelia. And other people that have done wrongdoings.

Ellie: I’m aware of that, and I have seen the videos. Well-

Peachy:
Yep, uh, have, you know, he’s made videos on people who have done wrongdoings he has a strong opinion on, or other things like that. But anyway, with that, TCS, first thing when I said that, he said in the VC, “Scott is gonna make a video on me.” Which, that’s hilarious, because Scott said he’s only observing the situation to see how it ends, and then he’s gonna jump in. Because we all know that, uh, Scott doesn’t… make videos out of the blue and he gets his information straight before he does anything. That’s the first thing he said, and he started running around blaming him for… everything, saying that Flying Scott hired me, that Flyer- Flying Scott was even… me, which makes no kind of sense, because FlyingScott is a man and I’m obviously a woman. But, (giggles), maybe I do sound like a man, I dunno.

Discord Guy 1: Well, FlyingScott is just a chameleon person.

Then, when Flying Scott made it public that he had nothing to do with this entire situation, TCS tried to suck up to him, likely to avoid a video about him (which Flying Scott immediately saw through). Maybe sensing this didn’t work, TCS banned Flying Scott the morning after he joined TCS’s Discord server.

Flying Scott:
Then, I find you in my Community Tab and in my comment section after I’d- I had to publicly state that I have nothing to do with this. Don’t think I don’t know what you’re doing there, laddie, you’re trying desperately not to make me make a video on you. You, you, you’re kissing my fucking heels in every one of these fucking comments, right, don’t think I don’t know what you’re doing!

Flying Scott:
I woke up on the 11th of September feeling sick as a dog, but I noticed something in my Discord server list was missing. A server owned by a certain Canadian. And when I asked my friends to give me an invite, I noticed I was banned.

While this is much later, when Joxic mentioned he was going to make a video on TCS, TCS implicitly threatened him in a Discord DM.
(TehCanadianSpartan.exe, 44:52)

I’m not sure if this got publicly released, but it seems in October of 2019 (based on its file name), TCS made a video compiling screenshots from the trolling group to make them look bad. Not only does it include screenshots from the “TCS is lying to you” Dropbox, but it includes some more edgy screenshots, them making fun of Ellie, and various threats and (frankly ridiculous) harassment from the group.

(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Funny_Video_TCS_made_in_October.mp4)

Speaking of only caring about reputation; while Ellie initially sided against TCS in the call, she later went on Twitter and made a long thread (A) changing her mind. In short, while TCS did do some bad things, she was “forced” to side against him in that call, TCS deserves a second chance, and what the accusers did to TCS after his apology was unacceptable, which is why she ended up siding with TCS.


Coincidentally, according to Flying Scott, Ellie made these tweets on the same day she ended her online relationship with Zeldaboy14.

Flying Scott:
Don’t think I don’t know you ended your e-relationship - which are fucking bullshit, by the way - with Zeldaboy14, conveniently on the same day you decided to side with our Canadian friend over here.

The trolling group then re-invited Ellie back into the server sometime in late 2019 (based on the audio file’s last modified date), to confront her about her siding with TCS. While Ellie had already distanced herself from TCS at this point, it seems to go nowhere at first. But then, at 6:48 in the audio file, Plormby (another minor who TCS talked about sexual stuff with but sided with him) joins and starts raging at Peachy. There’s nothing really informative, but I recommend listening from 6:48-20:08, as I found it really funny. However, I will warn you that there is earrape and screaming throughout said section of the audio file.
(TheCanadianSpartan Dropbox\Audios folder)

Plormby starts to rage against Peachy, but the staff in the Discord server start screwing with the guy. Throughout the call, people start earraping the call until Peachy starts reining in the staff and muting people. Soon, Plormby’s girlfriend joins to help Plormby out. Someone in the call starts impersonating Obama and making crude jokes. Moka tags in and starts arguing with Plormby, but at this point it stops getting funny.
Plormby (towards Peachy):
I have bigger fuckin' balls than you do, so don't even be talking!
Plormby:
Let me crack my knuckles right now, bitch, because I'm bout to find your fuckin' house address.
Plormby:
You literally fucking suck dick for goddamn money!

Peachy:
Hell yeah I do! What's your point?
Plormby:
BITCH! Try and fucking come up at me in real life! I will literally fucking beat your goddamn ASS!

Peachy (in background):
WHAT?! Who are you?! I don't know who you are!
Plormby's GF:
So I heard a bitch was trying to come for my boyfriend.

Peachy:
Hell yeah, cute, like fuckin' sister and brother- hell yeah, rednecks for life. I like that e-hog fucking, suck dick too.

Plormby:
Bitch, you probably live in fuckin' Alabama and fuck your brother for a living, shut your bitch ass up.

(chatter)

Obama Impersonator:
Look at all these wildin' children. Jesus Christ.
Peachy (sing-songy):
What's your defense, ho? What's your defense? (continuing in the background)

Plormby:
SHUT YOUR FUCKING MOUTH!

Obama Impersonator:
He gonna come up fo' dat asshole! He gonna pull up, come fo' dat ass, and show you why it's called the "White House."

Background person, quietly:
E-girl fight we've been waiting! E-girl fight! (Ellie: Uh, excuse me...) No, it's the e-girl fight!

Obama Impersonator:
You already know, I've been to the e-girl-

Peachy:
What's your defense, ho? What's your defense?

Plormby's GF:
Ok, oh so you wanna call me a ho? (Ellie: Excuse me?)

Peachy:
What's your defense, ho? What's your defense?

Obama Impersonator:
Man, this reminds me of my middle school days.

Ellie:
Hey, uh, scusi, where's the popcorn?

Plormby's GF:
You literally fucking suck dick for a living.

Peachy:
Hell yeah I do! I love sucking cock! (Hater's GF: Oh my god...)

Obama Impersonator:
See-

Plormby:
You literally sound like Belle Delphine (unintelligible)

Plormby's GF:
She sounds- she sounds like she could be in a fucking hentai or some shit (Peachy Hater: Legit!)

Peachy:
I- I am, I am actually- I- Is there any like, jobs open? I mean I'm kinda full right now, but I mean I could go for some more jobs. Money is always a good thing.

Plormby:
You literally fill yourself with fuckin' cum bitch, shut up.

Peachy:
Fuck yeah, I do. And it's really nice.

Obama Impersonator:
I mean, why else you think it's called the "White House"?

Peachy:
Exactly, I'm a fuckin' sperm whale, bitch.

(Someone laughs loudly)

Ellie:
Do you really need to release that much sperm for the White House?

Background Guy:
I'm more of a thot than all you all, I'm the god of sucking dick.

Moka:
Yo, I lowkey saw like a bunch of people in here, so I wanted to hop in. What's going?

Obama Impersonator:
This is the battle of the OmegaLolz.
Moka:
Hashtag- “#JusticeForTCS!” (laughs)

Plormby:
I’m not one of those people-

Plormby’s GF:
I didn’t even jump in (unintelligble) just for him-

Moka:
These niggas retarded!
(TheCanadianSpartan Dropbox\Audios\Plormby The White Knight Gets A White Knight.ogg)

With how TCS treated Peachy and his reaction to being exposed, Kaylanime really dodged a bullet and made the right choice in friendzoning him early. As bad as this was, both TCS and Ellie (along with quite a few other big names) would get into another controversy later that almost dwarfs this one.
 
Last edited:
Jacktropolis​
(Welcome to the Jacktropolis YouTube Channel!, 0:05)


Before talking about the Lewd House, I want to talk about Jacktropolis, whose drama is almost as ridiculous as the ones covered so far. Jacktropolis was one of the few people in the SplatSource community to have a girlfriend also in the community, RudyOctolingVA (a.k.a RudyOctoGamerVA), ever since May 8th, 2019.
(Splanimations Archive article on 2019)

Since Rudy was friends with TCS, Jack and TCS predictably interacted with each other. They seemed to be friends at first (especially after TCS helped “take down” Brian Jackson II), but things started to sour because of politics. Specifically, Jack is a Communist, which TCS strongly disagreed with. These political differences got to the point TCS went to Jack’s Discord server on an alt to cause trouble.
tcsjackbeefserver.jpgTCSjackbeef.pngTCSinjacksserver.png
(TheCanadianSpartan Dropbox\TCS Anger issues folder)

However, they seem to have made up between then and July 2019, as when TCS initially got with Peachy, Jack congratulated him.
shameitwontlast1.pngshameitwontlast2.png
(TheCanadianSpartan Dropbox\Peachy Incident folder)

This cordialness was brief, as their friendship permanently soured when TCS tried to break up Jack and Rudy’s relationship during the Peachy drama, specifically by TCS using his fans to pull Rudy away from Jack (sometime before mid-January 2020).
(TCS is lying to you Dropbox\unknown-8)(Jacktropolis Google Drive\Playing The Victim\Using Rudy As A Shield folder)(Jacktropolis Google Drive\Playing The Victim\Using Rudy As A Shield\Using Rudy As A Shield.JPG)

While trying to pre-emptive squash drama related to TCS and Peachy, Jack got into drama concerning his Discord server management. While these two videos (“Skylar Karategirl: Pretension Incarnate” and “Jacktropolis: World’s Worst Server Owner” respectively) aren’t that important to the main event, they do paint a good picture of Jack.
Skylar video:
In October 2019, Skylar Karategirl (who became TCS’s new girlfriend; looks like Peachy was right to start an argument about TCS’s “squishes” with her, even if it was an act) started to cause drama in Jack’s Discord server, targeting the mods who were also part of the TCS-Peachy situation. Skylar gets banned, but then in her Discord server she threatens to end all contact with Jack until he fixes it.

Jacktropolis video:
As expected of a Communist, he rules his server with an iron fist. TCS banned Ishi for his involvement with the TCS-Peachy drama despite him technically not breaking any rules. Staff disagreed and brought him back, and Jack freaks out about it. After Skylar got banned, Jack unbanned her. Skylar had sent in spies, so staff went to ban them. As expected, Jack freaked out and unbanned them as well. Server staff confronts Jack about his management style, to which Jack gets defensive and plays the victim. During all of this, the staff were in a group chat created by Scott (not Flying Scott) collecting evidence. A Polish Guard, invited by Nifty, mentions he would make a video about this; in response the server gets deleted and both Jack and Scott throw Nifty under the bus.
If you want to see a more in-depth explanation of these two videos and his past, check out this post here.

Remember how Jack said he was about to meet up with Rudy again in November when TCS tried to break them up? Well, on November 8, 2019, the Seven Deadly Boomers revealed that Jack was cheating on Rudy by ERPing with the 14-year-old QueenLoriVA over Discord.
(Content Crasher: Jacktropolis, 0:58)

While the Tweet itself is gone, the leaked DMs from that Tweet used in a callout Google Doc by LtBlazeWwW (which itself is also gone, but shown in full in another video).
(Jacktropolis' Downfall - The Saga Continues, 5:16-10:37)

Cheating on his girlfriend with a 14-year-old is bad enough, but:
Lori was the girlfriend of one of his friends and most loyal Discord admins, KingRyanVA / Crimson:

Ryan:
You have been my, quote-unquote “friend,” for, hmm, how long? I’d say- I’d say since… last fucking year, man! I have been your admin since January, this fucking year, man! And… And I’ve helped support your fucking relationship, I’ve helped, I’ve thwarted-

Jack:
No, you’re a really good person Ryan, you’re a really good person.

Ryan:
I’ve thwarted raids from your fucking server, I’ve thwarted fucking… 5-year-olds from tearing down your fucking reputation, AND THIS IS THE PAYMENT I GET?! THIS IS WHAT I GET FOR DOING THIS?! ARE YOU AC- this is what I get for doing all that for you? Really, really? Do you- do you think- do you think that is human fucking decency? Do you think, I get- this- (sighs) This is the shit I get for helping thwart many threats from your rep, your server, your relationship? And you tear down MY RELATIONSHIP?
Jack lied to her and told Lori that he had broken up with Rudy:

Ryan:
Because I… have just got a message from Lori, saying that she didn’t know, and that… that Jack was broken up with Rudy.
Jack knew about her age since (at least) July 12, 2018:
(Jacktropolis Google Drive\Evidence\Aftermath Of The Lori Incident\Tempted, Jack WAS aware of Lori_s age.png)
Lori was also his ex who kept trying to get back with him, according to her older brother Alex Allstar16 (yes, the Heavy the Squid fan who raged at PickSurprise back then :story:):

Mr. Bubblegum:
Um... so, okay, so next question. Where... uh- when were you aware that Jack is, um, dating Lori?

Alex Allstar16:
I've been aware since day 1, after I- after I- always- when she started talking to him... They used to date; you know, since, L- Lori is my little sister.

Mr. Bubblegum:
Yes, she is.

Alex Allstar16:
Since it's my job to look out for her... Since, ever since their breakup, she's been trying to get back... together with...
Jack first got with her when she was either 13 (based on the file name of the GMOD poster) or 12 (if LtBlazeWwW is correct):
(Jacktropolis Google Drive\Evidence\Aftermath Of The Lori Incident\Age confirmed by AlexAllStar [OUTDATED].png)(Jacktropolis Google Drive\Others\Images\Jack x Lori Lasted Since 8-15-2018 to 5-6-2019.jpg)

LtBlazeWwW:
...a lot more stuff was leaked about Jacktropolis on LolAttack's… uh... I found out that... when Lori was, frickin' 12, Jack had dated her, when he was 16!

BruhNolaBar:
Oh shit, I forgot about that!

LtBlazeWwW:
Yeah, he cheated on his girlfriend with his EX! That- this isn't something that you should see in real life, this is something that you should see in like a, frickin' romantic comedy!

And he did the ERP while he was 17, but stopped when he turned 18.

Splat God:
Jack was 17, she was 14, so technically it's okay.

Jacktropolis:
And I said no! I said that!

Jones:
But- but then you did it to her. But then you kinda did it, my man.

Jacktropolis:
No, I mean after this whole thing. This whole thing with the DM (unintelligible). I said... 18...

Jones:
Ok- Okay, and that- and that's... so you weren't technically a pedophile, but like... so it your- so you're not a pedo then, right, okay, so we got that (Jacktropolis (saying he's not a pedo): No.) established you're not a pedo. You came damn near close, but, you technically are not a pedo.

30 minutes after the Tweet, Jack would go into a Discord voice channel with members from both Jack’s Discord moderation team and the Seven Deadly Boomers.

BruhNolaBar:
And then, 30 minutes after tha- that Tweet, in his server, there was a call.

  • Some chatter talking shit about Jack before he joins
  • Jack joins, one of the first things he says is that he is fine with this being recorded (keep this in mind for later)
  • Throughout the call, Jack self-deprecates and self-flagellates (and as a result is very hard to listen to)
  • Ryan says that Lori and him (Ryan) were happy with each other, so why did Jack do the ERP?
    • Ended up shouting at her in Instagram DMs
  • Somehow Jack forgot about the Seven Deadly Boomers tweet and had to be reminded of it mid-call
  • About a week prior, Jack DMed Ryan about how happy Lori was, and talked about a plan to pretend to break up with Rudy
    • Probably related to these Discord DMs in the Google Drive (in the Jacktropolis Google Drive\Evidence\Lori Incident)
      • Lori1.jpgLori2.jpgLori3.jpgLori4.jpg
    • Lori said that Jack said he broke up with Rudy
  • This all happens a month after the staff collectively revolted against Jack's tyranny
    • The server has at least 21 rules, and the staff had to fight to get Jack to re-instate the 21st rule that gave them power
  • Ryan says he was one of the most loyal admins/defenders
    • Had been friends since ~November 2018
    • Has been admin since January 2019
      • Stopped raids in Discord server
      • Thwarted 5-year olds from tearing down his reputation
      • Supported his relationship with Rudy
  • Ryan broke up with Lori because of this
  • Ryan talks about how he wanted to "blow his fucking brains out with a rifle" when he got DMed the evidence
    • Didn't do it because he knew it wouldn't solve the problem; better to confront Jack
  • How will Jack apologize this time?
    • Jack says that saying "Sorry" isn't enough but he doesn't know what to do
    • Group agrees that his previous apologies were half-assed and not worth much
    • He can't really apologize for this
    • Jack suggests he should just leave the Splatoon community, group agrees
    • Group jokes that he was following a trend of thinking with his dick instead of his head (TCS, Lewd House)
  • Jack explains that he did the ERP because he was trying to make Lori happy
  • Ryan talks more about Jack's Discord DMs
    • Jack: “Rudy has told me she is okay with me telling Lori that me and her are just friends"
      • Faking a breakup with Rudy to Lori
    • Ryan rejects it, Jack says he "won’t bother going through with my plan to do 'it' " (he did it anyway)
  • Jack ramps up the self-deprecation around this point
    • Sounds similar to TCS
    • Starts crying around 17:00
  • Ryan starts talking about him being mentally unwell
    • Night Ryan got with Lori, he got into an argument; Lori's sister Erica pissed him off so much he sent a picture implying he was about to cut himself
    • Jack tries to paint himself as worse
      • Immediately shut down by Blazin pointing out that Jack is in a "better" position than Ryan is right now
    • Ryan is diagnosed with depression and PDA autism by the NHS (yes, he's British)
    • Ryan had a lot of suicidal thoughts going through his head because of Jack
    • Ryan is 13
  • Attempt to wrap it up, interrupted by Jones
    • Jones doesn't really care about / believe what Ryan said
  • Repeat of "How is Jack going to apologize for this?"
    • Jack is told to focus on his own interests over sexual desires (especially ERP)
      • Jack wants to become a history teacher
    • Jones lays some hard truths about the SplatSource community
      • It's a hugbox
        • Everyone leeches off of each others' popularity
          • How the community started off in the first place (following one dude who got popular doing Splatoon GMOD/SFM)
        • No one ever criticizes each other
        • If you give criticism, people lose their shit
    • Jones and the others help Jack figure out how to exit the SplatSource community
  • Jack starts crying again at around 27:00
  • Jack and group decide to give the Jackopolis Discord server to Ryan
  • While the group hates Jack, they don't want him to kill himself
  • Jack has become the thing he has banned in his server (a pedo)
    • Splat God (?) asks why he did in the first place
    • Another person makes it an example of the "sexual deviancy" in this SplatSource community
  • Why do people turn a blind eye to this type of drama, and only listen when it directly affects them?
  • Jack cries about possibly not getting his friends or his girlfriend Rudy back
    • Jones tells him it wasn't a real relationship anyways, thinking that Jack and Rudy are e-dating
    • Jack clarifies it was a long-distance relationship
  • Splat God talks about how people in the SplatSource need to stop forgiving people like Ellie Godelia and Geofcraze634
  • Group talks about how Jack can still recover from this and have a second chance
    • They also tell him he needs to stop self-deprecating and focusing on his mistakes; instead he should focus on improving himself
      • Jack immediately begins to self-deprecate after hearing this
  • While Jack is ranting about not deserving forgiveness, someone starts playing the first few notes to Megalovania on a MIDI piano
  • Jones tells Jack to lay off the Internet and the ERP, or he will end up doing some more pedo shit
  • Jack says he didn't have any pedophilic intent when he did the ERPs (?)
  • Splat God "clarifies" that pedophilia is a mental illness and not "just" against the law (??????)
    • 43:01 in the full recording (timestamp for if you want to listen to this)
    • He says "you can be a pedophile whilst not breaking the law" (??????)
    • You "only break the law once you start being like, over 18 and having ERP" (??????)
    • I really hope Splat God was trying to make Jack feel better or something because this is really suspicious-sounding
  • Jack was 17, she was 14 when he did the ERP so it's "technically" okay and "legal"
  • Jones tells Jack he ought to leave because Jack will keep beating himself up about this
  • Jones compares Jack to Donald Trump, tells Jack he built a wall
    • Says "like that one Russian dude said, tear down this wall!"
    • Tells Jack that he needs to "better himself" and calls him "my nigga"
      • Jones saying “nigga” derails the call for a bit
  • Some of the guys also say it's not really pedophilia, since he hasn't physically touched kids
    • Jack admits to being a virgin
    • Jones says that while Jack isn't the 40-year-old pedo creeping on the playground now; if he keeps ERPing, he will become that
    • Jack should never have responded positively to Lori inviting him to ERP
    • Jack came damn near close to being a pedo
  • Jones tells Jack that ProJared was innocent, so why can't Jack?
  • More "best thing Jack can do is leave the community"
  • Another dude with an accent basically repeats the advice that was already said to Jack

After this disaster of a voice call, Jack tries to get a hashtag going and fails miserably, according to BruhNolaBar.

BruhNolaBar:
Alright, so during the aftermath of Judgement Day [referring to November 8th, 2019], Jack tried to make a hash- making a hashtag... Ju- #JusticeForJack. Which didn't do him- well for him, because it didn't last that long. Even trolls were using it to make fun of him.

I guess sometime after that, LizzieRatcicle distanced herself away from Jack and/or something negative about him, because on her birthday (November 25) Jack called her “NaziRatcicle” :story:
(Jacktropolis Google Drive\Evidence\Harassment Towards Clauds\Calling Clauds A Nazi On Her Birthday.png)

Jack eventually uploaded an apology video, announcing his retirement from the Splatoon community.
PreserveTube

(Jacktropolis Google Drive\Others\Videos\I_m Retiring From Animating......mp4)
  • Jack feels horrible for what he has done, apologizes for what he did
  • Jack needs to focus on his real life
  • Jack is announcing his retirement from animating and Splatoon community
  • Jack apologizes to anyone who he has ever hurt, betrayed, or let down
  • All future planned animations are cancelled, all current videos will be playlisted
  • Repeat of needing to focus on real life
  • Channel will be going through rebranding process, away from Splatoon and towards history
  • Thanks his fans for the past support, and apologizes to them, won't stop them if they leave
  • Will take some time away to become better
  • Says he's a really good person who make a big mistake, apologizes again

He also uploaded an apology on his DeviantArt account, and according to Flying Scott, compared himself to Bill Clinton :story:

FlyingScott:
He also addresses the first time he cheated on his DeviantArt, but he literally compares himself to Bill Clinton in that essay, so just don't bother. We get it laddie, you like history, but other than liking history, you don't actually seem to do ANYTHING as a content creator.

Apparently after these apologies, his friends and everyone in the Anti-Inkling forgave him (yes, even Ryan and Rudy, somehow) because they believed it was personal relationship drama that got Jack too much hate, and most of them had a common enemy in TCS.

BruhNolaBar:
Now 4 of these were correct: Jack's online reputation was in crumbles. Rudy claim- claimed that she broke up with Jack- which she didn't. Anti-Inkling broke ties with him for a little bit, until Splat God said "What he did wasn't illegal." Which what Jack did was definitely illegal. His friends would break ties with him, and some were tricked by Jack to his apology on Discord and DMs. And he DID make a- a generic apology video, which was awful.

LtBlazeWwW:
Yeah. Um, so yeah, uh, yeah I did forgive Jack. Um, and uh, because like, uh, him and I agreed that relationship drama is personal, and it really shouldn't have- he really shouldn't have gotten the amount of hate that he did. Um, and then eventually even Ryan forgave him.

BruhNolaBar:
Yeah, I forgave him as well, pretty much the whole (LtBlazeWwW: Yeah.) Anti-Inkling like, group like forgave him for-

LtBlazeWwW:
Yeah, pretty much the entire Anti-Inkling- I wasn't in Anti-Inkling, but...

BruhNolaBar:
Yeah, you weren't. Yeah, I know you weren't because I was in it.

LtBlazeWwW:
Yeah. And- and um. So yeah, basically the entire Anti-Inkling group forg- forgave him, and then I forgave him. And uh, cause like we agreed, "Okay, yeah, this was personal." And he shouldn't have suffered this much from relationship drama, And like, for me, chose to forgive him.
(Jacktropolis' Downfall - The Saga Continues, 6:22)

Rudy had actually put out a statement where she stood with Jack and was against the Seven Deadly Boomers for exposing him.
Lower quality camera picture “archive” in Jacktropolis Google Drive\Others\Response\Rudy (Jacktropolis_ Girlfriend) folder)
(Taken from this post)

Despite saying he would “retire,” Jack continued to comment on SplatSource drama (especially if it included TCS and/or Skylar). I heard that Skylar set Jack up in the third screenshot to bait him, but I can’t find the source and all I remember about the source was it had screenshots of Skylar talking on Discord about it.
(Jacktropolis Google Drive\Evidence\Scummy Behavior\Dicktropolis Calling Out Hashtags.jpg)TehCuckSpartan.jpgWow, what a dick.jpgCalling Skylar A Wench.pngBruh3.png
(All except the first from the Jacktropolis Google Drive\Evidence\Harassment Towards TCS-Skylar folder)

During all of this, he would also make an infamous Splatoon GMOD poster of him “defending” Rudy from TCS and Skylar.
(Jacktropolis Google Drive\Others\Images\The Infamous GMOD Image.jpg)

Sometime in December, Jack uploaded an update video discussing how he will move away from animation. Of course, Jack didn’t miss an opportunity to snipe at TCS in the description of this video.

  • Making video to clarify where Jack has been the past month and to describe future of channel
  • Has been working hard on school and repairing past friendships because of the drama
    • Was given a second chance by his closest friends
  • Working hard on rebranding channel through history
    • Includes gaming, commentary
  • Recently did a poll asking if he should continue retiring from animation and focus on history
    • Majority of people said he should go back to animation and incorporate history
  • Jack will not retire from animation, but it will not be a priority on the channel
    • Mainly focus on history, gaming, commentary
    • Allows him to branch out to different topics
  • Will be back to making content, and even animations
(Jacktropolis Google Drive\Others\Videos\Updates & Announcements!.mp4)
(Jacktropolis Google Drive\Evidence\Harassment Towards TCS-Skylar\Fuck You TCS.JPG)

Alongside this “rebranding,” Jack deleted his December 8 apology video (according to BruhNolaBar) and made a new Discord server.

BruhNolaBar:
Jack went and made a shitty apology video, before deleting it on the 8th of December, because of his quote-unquote "rebranding."
(Jacktropolis Google Drive\Evidence\Discord Server Hackings\Bruh.jpg)

Things continued as usual, but then (according to BruhNolaBar) on December 22, 2019, Jack would Tweet:
I can't seem to escape TehCuckSpartan, and his witchy girlfriend because my girlfriend still chooses to be "octo besties" with them. Maybe someday, she'll break ties with them, after all they've done to me...
The following day, he started his crusade against TCS, worried that he and Skylar were trying to “brainwash” Rudy. It was also likely that Jack was worried Rudy would leave him for the more popular TCS (who had ~70K subscribers at the time).

BruhNolaBar:
It all started with a post on his T-Twitter on the 22nd of December, saying, "I can't seem to escape TehCuckSpartan, and his witchy girlfriend because my girlfriend still chooses to be quote-unquote "octo besties" with him- them. Maybe someday, she'll break ties with them, after all they've done to me..." And then- a- the d- a- the- starting the day after that, he started this quo- so-called "TCS Crusade" which- that ended terribly on 17th of... January 2020. And the only reason he started that was because... he saw it, TCS and Skylar were c- was controlling his girlfriend. And Jack thought they were trying to brainwash her, which was false. Rudy was just friends with them. Now that's what I call, a bruh moment!

LtBlazeWwW:
He was acting all paranoid, that TCS was "brainwashing" Rudy, which I mean... he kinda is, but Rudy's kind of a gold digger, since she's hanging out with a person that has more subs-

BruhNolaBar:
Yeah, yeah, TCS has- has like 70-

LtBlazeWwW:
Instead of hanging out- instead of hanging out- instead of hanging out with her girlfriend- her boyfriend, sorry.

BruhNolaBar:
Yeah, you're fine.

LtBlazeWwW:
Yeah, she chooses to hang out with a guy who has more subs, than to hang out with her boyfriend.

BruhNolaBar:
Yeah, pretty sure she- he- like, TCS has like, 7- 70K subs, I think, probably more.

A tweet shown in Flying Scott’s video looks like an example of one of the “crusade” Tweets.
(This YouTuber Is Even More Obsessed With TCS Than I Am, 3:16)

However, the “crusade” ended on January 17, 2020, because Mega Mattman uploaded his video “(Rantish/Expose): Let's Talk About Jacktropolis” that day.
PreserveTube
In the description of this video, Mega Mattman included a link to a Google Drive, which also contained the full chat logs between Jack and Lori, and initially contained the full chat logs between Jack and another girl named Minti. I’ve already covered some of the chat logs between Jack and Lori (at the end of this post) but I have to repost the final messages in the chat log :story:
(Jacktropolis Google Drive\Perverted Stuff\Lori\Full Chatlogs\Direct_Messages_-_QueenLoriVA_587870122279043073_1_1-1.html)

Minti’s DMs were removed due to “over harassment,” so all that remains is this DM. The specifics around him and Minti are explained by Jack later.
(Jacktropolis Google Drive\Perverted Stuff\Minti [False Due To Over Harassment]\Minti1.JPG)

For some people, Mega Mattman’s video was the first time they had heard about Jack’s ERP with Lori. For example, Lori’s own brother Alex Allstar didn’t know most of it until he saw the video.

Alex Allstar16:
I... don't know what- most of it, what's- what's going on, I've gotten aware from the video.

Lori also got banned from using Discord. I guess better late than never.

Alex Allstar16 (talking about how Lori wants to get back with Jack):
That ain't- gonna fly, since she can't use Discord anymore.

LizzieRaticicle probably said more negative stuff about Jack as a result, because the same day it came out, Jack vandalized the page of LizzieRatcicle’s OC Clauds on the Squidtopis Archives (A) and called her a Nazi Pedophile :story:
12

When Jack initially saw Mega Mattman’s video, he laughed it off at first, but then got mad once he realized part of the Discord call was included in the video.

LtBlazeWwW:
Right, yeah. Mega Mattman made the video and, uh, Jacktropolis posted it in some DM that we were in. Um, and he basically was all like, he was treating it like a joke, which, um, really isn’t surprising. I mean, if someone were to make a rant video on me and it was garbage, I would make a joke out of it. But, then Jack had said that, um, he’s like, “I thought it was something I could laugh at, but actually they included my meltdown.” Y- yeah, he- he got all pissy that um, Mega Mattman included the 25 minute segment from the 60 minute video of Jacktropolis having a meltdown, um.

He then proceeded to copyright strike the video, claiming “hateful and abusive content” in the links within the video description (referring to the Google Drive).
LMAO!.jpgLike he can actually pulled it off.jpg, taken from This YouTuber Is Even More Obsessed With TCS Than I Am, 4:35
(Jacktropolis Google Drive\Playing The Victim\Witch Hunting Saga folder)

Jack sent his fans towards the video to get it taken down (funnily enough similar to SunnytheInklingCat, someone Jack "exposed" in the past). When Jack got called out for this, he tried to play semantics games about his wording, and also said it was illegally uploaded as he claimed to never have given consent to being recorded.
Trying To Use Your Fanbase To Attack Me For Saying Stuff That Are True.jpg(Jacktropolis' Downfall - The Saga Continues, 15:16)Just because I live in PA, that doesn’t mean that you said that you are okay with recording...jpgBruh2.jpg
(Jacktropolis Google Drive\Playing The Victim\Witch Hunting Saga folder)

When confronted by LtBlazeWwW about his consent, Jack immediately repeated that he never gave it. However, after finding the full recording, LtBlazeWwW finds out that Jack had said, “I am perfectly fine, I am okay, with you guys recording this.” Upon finding out that Jack lied, LtBlazeWwW blocked him everywhere.
(Jacktropolis Google Drive\Playing The Victim\Witch Hunting Saga\Um, you were saying.JPG)

LtBlazeWwW:
So... I basically... blocked Jacktropolis, everywhere, essentially, and then he started making up excuses on his Twitter about how, like, he had forgotten about... saying that.

As other people also find the full call and start to call out Jack, Jack puts out a damage control Tweet.
(Jacktropolis Google Drive\Playing The Victim\Attention Seeker\You did it again, LMAO.JPG)

Eventually, Mega Mattman privates his video for some reason, which Jack claimed victory over.
(Jacktropolis Google Drive\Playing The Victim\Witch Hunting Saga\Wrong - My Exposing Video Is Set To Private.jpg)

During all of this, Jack claimed he would be ending all drama between him and TCS, and would not acknowledge TCS at all. Jack quickly went back on this statement, getting into an argument with TCS in a YouTube comment section.
(Jacktropolis' Downfall - The Saga Continues, 19:33)That did not age well.pngNo words for this.png
Jacktropolis:
I announced how I'm done with the drama, so... 🤷‍♂️ Yeah, you won't be getting what you desire. Go find a better hobby in your lives.


YouTuber commentor 1:
@Jacktropolis How about no.

TehCanadianSpartan:
@Jacktropolis You're done, but none of us are. You caused all of this yourself, not us.


YouTube commentor 2:
@Jacktropolis you are a hypocrite. you are still engaging in drama you moron.

Jacktropolis:
@TehCanadianSpartan Oh quit it with the empty threats already. You and your "friends" are just begging me to respond to your VIDEOS and CRITICISM and HARASSMENT. Well, I won't stand for your blatant mob mentality of witch-hunting me and not even letting me feel safe on the Internet anymore. Go find a new hobby instead of picking random people like myself to cyberbully, and maybe even get a life.


TehCanadianSpartan:
@Jacktropolis Nah, I enjoy getting under your skin and pissing you off after what you did to me and Skylar. Now you get to go through what I went through, because karma's a bitch. Hearing you cry and grovel in that VC was the greatest thing I ever heard because it's just like you said yourself, you're a fucking asshole. Stop constantly wanting attention, act your goddamn age, and go hide like the pussy you are, you fucking tyrant.


YouTube commentor 3:
>says he'll stop acknowledging TCS
>responds to TCS

seems legit
(Last two screenshots from Jacktropolis Google Drive\Playing The Victim\Attention Seeker folder)

This wasn’t the end of Jacktropolis’s drama, as Flying Scott (on his second channel Tea With Caramel) would upload “This YouTuber is Even More Obsessed With TCS Than I Am”.
PreserveTube
  • Makes fun of online daters
  • Jack and FlyingScott have met in the past, Jack was an advocate of his exposés in the past
  • All e-daters FlyingScott has known have had their e-relationships fail, due to horniness
  • Jack is in a relationship with Rudy (who herself has caused some drama)
  • Rudy is a cuck(quean), since Jack cheated on her twice with Lori and Minti, yet she still chose to stay with him
  • When caught the first time, Jacktropolis uploaded an apology (which is now deleted) on YouTube
    • In apology video, claimed to leave Splatoon community, despite still doing Splatoon GMOD stuff
    • Also put one on DeviantArt where he compares himself to Bill Clinton
  • Jack likes to make a lot of empty threats towards TCS on Twitter
    • Does it because TCS threatened to break Jack and Rudy up for not supporting him through Peachy and the Lewd House
    • TCS actually responded to some of Jack's threats/criticisms, when he usually doesn't do so when it's from others
    • FlyingScott also attacks TCS, but FlyingScott has evidence and purpose when he does so
  • Jack used copyright-strikes to take the video exposing him down
    • FlyingScott calls him a "miserable, cheating, lying communist"
    • Criticism is not harassment
    • Despite Jack ostensibly being against censorship, he is conveniently not against it when he's being criticized
    • If Jack didn't try to hold on to his reputation so hard, he would not have been criticized in the first place
  • People should just stop caring about Jack
  • FlyingScott tells Jack to "get a life"

Of course, Jack had to respond to the video. He was also allegedly the first person to dislike the video.
(Jacktropolis Google Drive\Evidence\Aftermath Of The Lori Incident\I wonder who disliked Scott’s recent video [Outdated].jpg)

But more informatively, he would post a comment defending himself, saying that:
  1. He only cheated with Lori, as Jack DMed Minti (with Rudy’s permission) to help Octo Luna expose her (This is why there are no more DMs nor a full chatlog between Jack and Minti (at least, not currently in the Jacktropolis Google Doc)
  2. He forgot that he gave permission, and acted impulsively
  3. FlyingScott didn't need to call Jack a "lying Communist," by doing this he contributes to the "mob mentality" bullying him on the Internet
(Jacktropolis Google Drive\Playing The Victim\Attention Seeker\Can someone bring him some diapers.png)

Jack would then take to Twitter to complain about the “harassment” he was getting, painting himself as a victim.
Your wanted to talk.jpgJack_s painting himself as a victim.jpgLook at this dude, LOL.jpgScreenshot3.pngWe have our reasons to go after you bitch, get a life.png
(Jacktropolis Google Drive\Playing The Victim\Attention Seeker folder)

In response to Jack’s behavior, LtBlazeWwW wrote up a Google Doc exposing him. While it has been deleted now, it was given its own section in “Jacktropolis’ Downfall - The Saga Continues” where Mega Mattman reads it in full.
  • Introduces Jacktropolis and his controversy with Lori
  • Displays the ERP chatlogs (which I believe are from the Seven Deadly Boomers tweet)
  • Quickly summarizes the call (Ryan yells at Jack, Jack calls himself a scumbag to garner sympathy)
  • Explains why he and others gave him a second chance
    • Relationship drama is personal, Jack shouldn't have suffered so much from it
    • Shared a common enemy, TCS
  • Why did LtBlazeWwW turn against Jacktropolis?
    • Mega Mattman uploads exposing video on Jack, Jack copyright strikes and takes it down
      • When questioned, Jack lied to his face; LtBlazeWwW found out the truth listening to full recording
      • Jack supported witch-hunting against Mega Mattman
        • Tried to weasel out of encouraging it by posting about it and hearting a comment implying commentor would do something
    • Jack won't shut up about TCS
      • Made GMOD poster defending Rudy against TCS and Skylar
        • This made Rudy uncomfortable, had to decide between her friends or her boyfriend
      • Claims to not acknowledge TCS on Twitter, still calls him "TehCuckSpartan"
        • Side note: at this part, Mr. Bubblegum in the video asks "The word cuck, isn't that a little racist to Canadians?" :story:
    • Guilt tripped Rudy
      • Said it was a slip, potentially lying about it
      •  (Jacktropolis' Downfall - The Saga Continues, 20:09)
    • Feuding with Kirin
      • Jack claimed Kirin hacked into his account to get screenshots
        • LtBlazeWwW was suspicious when Jack said Kirin hacked into his account while his VPN was on
      • Claimed Rudy was "too fragile and innocent" to collaborate with Kirin
        •  (Jacktropolis' Downfall - The Saga Continues, 20:09)
      • Was so paranoid, thought LtBlazeWwW's friend Joseph the Stupid Hedgehog was Kirin because they both had Sonic-related profile pictures
        • (Jacktropolis' Downfall - The Saga Continues, 25:20)(Jacktropolis' Downfall - The Saga Continues, 25:32)
      • Kirin didn't even hack him in the first place
        •  (Jacktropolis' Downfall - The Saga Continues, 26:35)
        • Jack made people unnecessarily scared of Kirin

Wisely, Jack makes a Tweet saying he should have not admitted to anything in that Discord call. After this (based on the “last modified” date of these files), Jack’s Discord DMs were leaked (either by hackers or by Rudy), showing Jack turning to Rudy about the drama.
(Jacktropolis Google Drive\Playing The Victim\Attention Seeker\LMFAO, this man never learns his lesson.JPG)(Jacktropolis Google Drive\Playing The Victim\Using Rudy As A Shield folder)
Chatlog1.pngChatlog2.pngchatlog3.pngChatlog4.pngChatlog5.pngChatlog6.pngEnd my suffering - DED.png
(Jacktropolis Google Drive\Playing The Victim\Using Rudy As A Shield folder)

On February 8, 2020, Mega Mattman would un-private the first exposé, causing Jack to freak out and try to report it again.
He just wanted his reputation back.PNGHe even sent me an email as well LMAO!.PNG
(Jacktropolis Google Drive\Playing The Victim\Witch Hunting Saga folder)

Unfazed, under a week later Mega Mattman would release a follow-up to his first exposé, “Jacktropolis' Downfall - The Saga Continues.”
PreserveTube

After it came out, Jack talked about the video on his DeviantArt and commented on the video itself.
Jack_s Reaction When He Saw His Downfall.pngJack’s comment on his downfall video.PNG
(Jacktropolis Google Drive\Playing The Victim\Witch Hunting Saga folder)

The very next day, on February 15, 2020 at roughly 4:45 PM EST, Jack’s staff worked with other trolls to raid his Discord server. The main participants were KingRyanVA, GeneticShowdown, Blazin, DjSwaggy, Jian, Kharn, and Astro (some of whom were the staff of Jacktropolis's old Discord servers). People started getting banned for calling Jack a pedo, but when a troll named SquidParty Oscar complained about Jack “censoring the truth,” Jack proceeded to ban him with the following message:
(Content Crasher: Jacktropolis, 10:24)

Oscar’s ban sparks the revolt/raid, causing the staff and trolls to go bananas.

BruhNolaBar:
Aright, so this was basically a raid on Jack's server, in which different trolls teamed together to get Jack's server shut down. It began on February the 15th, 2020, at around 4:40 PM EST, when Scott, Crimson, or Ryan, as you want to call him, GeneticShowdown, Blazin, DjSwaggy, Jian, Kharn, and Astro hosted an overthrow of Jack's server, in which because of several people getting banned for calling Jack a pedo. The noble- notable ban was SquidParty Oscar- which w- is a tr- big troller- getting very very mad and calling out Jack for censoring the truth. Jack tr- quickly banned Oscar, with him... saying, "For sparking drama in Jacktropolis's name, I ban thee." And that was the last roll- straw for the trolls. And they quickly spammed "MONKEY NOISES," which was important to this, into the #general chat.

The rest of the revolt was recorded and uploaded by Astro. I highly recommend watching the video/archive of the raid itself, but I will warn you; it gets pretty loud.
PreserveTube

(Jacktropolis Google Drive\Evidence\Discord Server Hackings\THE THREE DAY CAMPAIGN RAID.mp4)
  • Some of the staff change their name to "CEO of _", with varying levels of offensiveness, ranging from "CEO of e-dating" (poking fun at Jack) to "CEO of Muslim Massacre" (Scott) and "CEO of Super Columbine" :story:
  • Not only do they spam the phrase "MONKEY NOISE" in the Discord channels, they play a video of monkey noises through the Rythm bot on Discord
  • The raiders start making monkey noises in the voice channel, appropriately titled "Munkie Sounds"
  • During the spam, Jack (impotently) tries to get them to stop spamming
  • The raiders switch to spamming "PRAISE BJ"
    • BJ refers to Brian Jackson, someone who Jack hates because BJ harassed Rudy to the point of considering suicide
  • The raiders end up spamming MONKEY NOISE (Minti_cry emote) PRAISE BJ
    • Minti is the other person Jack was accused of cheating on Lori with
  • Right as CEO of Muslim Massacre (Scott) is about to give everyone mod to screw up the server more, Jack takes away her (?) ability to do so
  • Jack says, "Please stop ruining my server"
  • Raiders switch to "JACK IS A HETEROPHOBE"
  • DjSwaggy announces it's time to spam his "fanfic," a Google Drive link to an illustrated version of his (?) fanfic, Jack X Splat God X Sunny
    • File in Google Drive is inaccesible/deleted
  • Raiders start chanting to ban Rudy, also start spamming "BAN RUDY" and "NO MORE RUDAY"
    • They declare "RAPE TIME" on Rudy
    • In response, DjSwaggy says, "No one wants to touch that downie piece of shit!"
  • At this point, the Seven Deadly Boomers hijack Jack's Discord account
  • The raiders start spamming "Rudy x Minti" and spam-pinging her
  • Jack impotently says "@here EVERYONE STOP"
  • As the raiders start spamming "DO THE FAGGIE DANCE," Jack's hijacked account says he is going to delete the server
    • After he says that, Jack's hijacked Discord account starts spamming "DO THE FAGGIE DANCE"
  • Jack joins the voice call, the raiders proceed to make monkey noises towards him until the server goes down
I assume the fanfic spammed in the raid is an illustrated version of this fanfic, written under the pseudonym of generaldabbers.
The contents of the text are very NSFW, to put it lightly. Underneath the spoiler, I have copied the text from the fic to here as a make-shift archive.
Sunny and Jack were fucking in Jack's appartment doing the usal like Sunny shrinking Jack and shoving him up her womb or Jack shoving the butt of his rifle up Sunny's ass and using it as a dildo. They usally fuck till 9 pm but today it endned pretty early due to Jack's ball sack running out of bullets for Sunny to drink. They were eating a pizza which Jack nutted on Sunny's side of the pizza to add a creamy flavor to it. It was just a regular day anyways for the dou till somebody rang the door, Jack pulled up his trousers and went to the door. It was SplatGod at the door with his 30 inch punisher showing, Jack know what's up starting to suck his cock deepthroating it the cock hitting Jack's tummy. Sunny hearing the commotion walked to the door, JaCk WhAt Are YoU DoIng? Sunny said soundling like a retarded dolphin. Sunny just looks at Jack with the bruh face. Sunny went sicko mode her pussy getting wet in the matter of 000.001 seconds, she started to suck Jack's asshole shoving her tongue in Jack's ass.

SplatGod cum in Jacks mouth causing Jack's stomach to mix with his stomach acids, It took a few seconds till Jack started to throw up cum acid. Jack fell on the ground Making sunny use her strap and started to penetrate Jack's asshole making it bleed a little and SplatGod shoving his punisher into Jack's left ear, hitting Jack's brain. Jack was screamin in pleasure and pain making him nut. Sunny was slapping his ass and SplatGod splatting in Jack's head making his brain full of cum. Jack barely getting up started to rape Sunny for penetrating him so he shoved his cock into her mouth and SplatGod shoving his cock into her asshole both cocks couple of inches from touching. Sunny was moaning but it couldn't be heard due to her the clapping sounds of both Jack and SplatGod fucking her holes, her face was like that of a downie ahegao face.

The neighbors were hearing the whole thing making them wanting to kill themselves and some actually ending themselves due to Sunny's downie screaming. They called the downie destroyer PickFan the Second, the destroyer of downies and sometimes fuck their hot mom. Part of the Anti tard special force called 7 deadly boomers the leader being Ishi and his boy toy-second in command Kirin. When PickFan heard what was going on he was more angry than a incel when their waifu is getting flamed so he drove off to the destination.

SplatGod was raping the ever shit out of Sunny while Jackwas raping her mouth. Sunny keeps on almost drowning in Jack's communist flavored cum. Both SplatGod and Jack nutted at the same time making Sunny pass out due to the amount of cum there is in her stomach. Her belly looks more fat than Jabba the hutt's, Jack curbstomp on Sunny's stomach causing all of the cum come out of her ass and pussy. Sunny made a noise that was never heard by any tard before. PickFan could hear the noises and called for backup. In a blink of an eye all the deadly boomers came barging in the apartment shooting tranq darts at both SplatGod and Sunny but Jack started to run away. Jack made it to some alleyway and as soon as he saw another downie near the dumpster he started to rape her. Her name was Minti. Jack was shoving his Commie cock down her ears making her head and ears covered in cum.

Minti was sucking off Jack and receiving Communism through her asshole and smelly ass pussy which smelt like fish. Minti was screaming in pain due to jack using a rusty pole as a butt plug, you thinking like oh its just a metal pole with rust but this pole has some barb wire, the rust made some sharp points on it too so Minti's ass and pussy were bleeding due to it. Minti was a masochist though she was in pleasure from Jack's harsh treatments. HARDER HARDER the tard screamed Jack thrusting the pole and his pee pee into her holes. Shots were fired causing the downie duo to fall. Jack was filed for rape due to him rapping Minti so was she to prison and later on evidence was found of domestic abuse against his ex wife Rudy. Splat God, Minti and Sunny were sent off to Siberia where the tard camp was. Basically it's a place where tards live, It's a normal city but filled with only tards and wranglers that give them their food.

20 minutes after the raid started, the server gets deleted. Jack makes a Tweet after the event. After this, the hackings on Jack’s Discord accounts started to ramp up, to the point Jack had to make a public statement about them.
(Content Crasher: Jacktropolis, 10:50)
PreserveTube

(Jacktropolis Google Drive\Evidence\Discord Server Hackings\Jack_s Statement on Hackings of his Accounts.mp4)
  • Starting in November, Jack's Discord account has been the victim of hackings
    • Includes posting racist, homophobic, discriminatory, and pornographic messages and images in DMs, removal of Discord account from servers, blocking every single online friends on friends list
    • Started as just removal of all servers Jack was in, now escalated to posting racist and pornographic images in servers Jack was in, getting him banned
    • Says none of the stuff the hackers sent was him, condemns the hackers
  • February 16-17; somehow hackers got into his account from his IP address (?), spamming more “vile” content (saying racial slurs a lot) in attempt to tarnish online reputation (more)
    • Posted discriminatory messages to people in friends list, including Rudy (got blocked by hackers, prevented Jack from clarifying)
  • Earlier in 2020, Jack made a private Discord alt to make sure that he could still contact certain people
    • February 17, hackers got into the private alt and started doing the same stuff, was accused on Twitter of using alt to raid Discord servers and spam racist/pornographic messages
    • Was clearly hacked by same group that got original account
    • Jack clarifies this was not done by him
    • Hackers continued to “infiltrate [Jack’s] IP address which is linked to all of [his] accounts” (?), compromising his privacy, vandalizing it
  • Jack reported situation to Discord Trust and Safety team
  • Jack threatened legal action if not resolved quickly
  • Currently and temporarily suspending all Discord accounts immediately
  • Anything supposedly from the “Jacktropolis” Discord accounts is now not from Jack
  • Jack tells trolls to stop doing this

As usual, after these hackings Jack started playing the victim. He also got into an argument with ThetaRexVA, who was a friend of both him and Rudy.
(Jacktropolis Google Drive\Playing The Victim\Attention Seeker folder)
Aww, needs some help_.jpgJack, take a fucking break man.jpgWe know our routine Jack, get over it.jpgComparison other people will add more fuel to the fire, stop this.jpgBoomer1.jpgBoomer2.jpgBoomer3.PNGBoomer4.jpg
(Jacktropolis Google Drive\Playing The Victim\Attention Seeker folder)

While Rudy tried to defend Jack, Jack kept losing support; by the time of the Content Crasher video on him, one of his few remaining defenders blocked him
Uhhh.jpgHypocrite she is.jpgOh god.jpg
(Jacktropolis Google Drive\Playing The Victim\Using Rudy As A Shield folder)

LtBlazeWwW:
...pretty much no one I've seen, have forgiven him, except for princesssofia[254] and... Splat God.

BruhNolaBar:
Splat Go- uh, I actually know this from one of my sources. Uh-

LtBlazeWwW:
Yeah?

BruhNolaBar:
Somebody said that Splat God actually blocked Jack... I'm not joking 'bout that, he blocked Jack.

LtBlazeWwW:
Hm.

Being an artist, Jack created some Splatoon GMOD posters to express his feelings during the exposés, hackings, and server raids.
Don’t even THINK about tearing us apart….jpg#EndJacktropolis.jpgGetting Used To The Hate.jpgThe Hate Is Stronger And It_s Working.jpg
(Jacktropolis Google Drive\Others\Images folder)

As Jack got more and more isolated, some people were getting worried. Scott, one of Jacktropolis’s former Discord admins and creator of the Jacktropolis FANDOM Wiki, shut down said wiki in fear that Jack would do something drastic. Interestingly, the message announcing the shutdown calls him a lolcow. Note: this image is viewable in the Jacktropolis Google Drive, but will be broken if you download it; if you want to view it locally, you will need to change the file extension to .png.
(Jacktropolis Google Drive\https://jacktropolis.fandom.com/wiki/Jacktropolis/Wiki)

Funnily, Jack had also supposedly called the cops about this drama, and they told him to delete his account :story:

BruhNolaBar:
It's funny, because he call- he called the cops, like, uh, about h- ha- him getting hated on social media, and I think the cops said, like, uh, "Delete your account."

Things would return to relative normal after a while (barring some drama between Rudy and Mega Mattman), but the relationship between Jack and Rudy starts to show cracks. Inevitably, on July 19, 2020, Rudy and Jack would officially break up (archive).
(Cropped from Jacktropolis Google Drive\*BONUS*\Thumbnail [resize it to 1280 x 720 in order to be more accurate].png)(Splanimations Archive article on 2020)

While it was supposed to be private and peaceful, Rudy chose to make it public and expose Jack at the same time, which Jack ranted about in a DeviantArt post.
(Jacktropolis Google Drive\*CANCELLED*.png)

Jack would soon leave the Splatoon community for real, turning into a “German Shepherd Union Soldier” VTuber. It’s not really relevant to SplatSource, but if you want to read more about that, check out this post here.
 

Attachments

Last edited:
Lewd House​
discord-round-color-icon.webp

And finally, the most infamous controversy of SplatSource. As stated before, the Lewd House’s existence was revealed during the drama between TCS and Peachy. TCS also states that Clauds (LizzieRatcicle) and ghostoftime1 created the server; based on this screenshot, the server might have been created sometime in mid-to-late 2018. In another Discord DM, TCS told someone else about the Lewd House, revealing that big names in the community were in it at the time.
(Lewd House Heist SFW Dropbox\TehCanadianSpartan\tcsinvitingpeachytolewdhouse.png)(Lewd House Heist SFW Dropbox\Underage Historial\Genesis\genesisfirstjoindate.png)(Lewd House Heist SFW Dropbox\creepcirclediscovered.png)


However, the degree of degeneracy wasn’t divulged until Rosy the Octoling entered on September 17, 2019, to gather evidence for the Seven Deadly Boomers (also giving credence to the idea that the SDB were behind Peachy, as they were likely the first to know about the server), according to the Splanimations Archive.
(Lewd House Splanimations Archive article)

What Rosy the Octoling found was quite shocking. As expected of an NSFW server, it had channels for general chatting, sharing porn, sharing NSFW materials (for NSFW GMOD/SFM posters), and general ERP. Of course, porn was shared and made in said “sharing porn” channels, some of which were very gross.
(Cropped from Lewd House Heist SFW Dropbox\Ellie Godelia\EllieGrossNSFWshit2Censored.png)
EllieGrossNSFWshit1Censored.pngEllieGrossNSFWshit2Censored.pngEllieGrossNSFWshit3Censored.png
(Lewd House Heist SFW Dropbox\Ellie Godelia folder)

ghostoftime1example3censored.pngghostoftime1NSFWpic1Censored.pngghostoftime1nsfwshit1Censored.pngghostoftime1nsfwshit2Censored.pngghostoftime1nsfwshit3Censored.png
(Lewd House Heist SFW Dropbox\Ghostoftime1 folder)

LizzieGrossNSFW1Censored.pngLizzieGrossNSFW2Censored.pngLizzieGrossNSFW3Censored.pngLizzieGrossNSFW4Censored.png
(Lewd House Heist SFW Dropbox\Lizzie folder)

tcscommissioningporn1censored.pngtcsdisgustingnsfwcensored.pngTCSgrossNSFW1Censored.pngTCSgrossNSFW2Censored.pngTCSgrossNSFW3Censored.pngTCSgrossNSFW4Censored.pngtcslewdhousensfwCensored.pngTCSnsfwShitLHCensored.pngTCSskylarrequest.png
Lewd House Heist SFW Dropbox\TehCanadianSpartan folder)
When questioned about it, Skylar claimed she never requested, with ghostoftime1 adding that TCS made revenge porn of people’s OCs if he didn’t get his way.
(A Lesson On Who To Trust, 55:15)(A Lesson On Who To Trust, 56:12)

LHbestialitydegenerate1Censored.pngLHgrossSonicPorn1.pngmiscLHgrossNSFW1Censored.pngmiscLHgrossNSFW3Censored.png
(Lewd House Heist SFW Dropbox\Miscellaneous folder)

It wasn’t just fictional pornography; Ellie had sent a nude of herself in the Lewd House. According to ghostoftime1, she was the only person in the server to send nudes, and this nude was unsolicited.
(Lewd House Heist SFW Dropbox\Ellie Godelia\elliedisgustingnudeCensored.png)
(To Catch a Squidette, 8:35)

There are many examples of gross ERP in the Lewd House Dropbox, but one alarming example is Ellie starting to roleplay with Federxblue, where Federxblue pretends to be underage. Speaking of roleplay; in roleplay terms, the Lewd House was some sort of sex mansion. Along with the rooms typical of a house, it had rooms for what seemed like particularly active members.
(Lewd House Heist SFW Dropbox\Ellie Godelia\idontlikewherethisisgoing.png)(Cropped from Lewd House Heist SFW Dropbox\Ellie Godelia\EllieTCSERPlog1.png)(Cropped from Lewd House Heist SFW Dropbox\Miscellaneous\LHbestialitydegenerate2.png)

Like almost every other Discord server, it had a voice channel. If one was so inclined, one could listen to their fellow members (some of whom were ESL) masturbate alongside them.
(Lewd House Heist SFW Dropbox\Miscellaneous\LHerpVC2.png)

It also had some freaky lore.
LHweirdasslore1.pngLHweirdasslore2.pngLHweirdasslore3.pngLHweirdasslore4.png
(Lewd House Heist SFW Dropbox\Miscellaneous folder)

This is frankly pretty degenerate, but it could probably be accepted (and mocked) by the community if it was kept small and adults-only. After all, ghostoftime1 was “very selective about who joins” the Lewd House.
(Lewd House Heist SFW Dropbox\TehCanadianSpartan\tcsrejoinsthelewdhouse1.png)

However, ghostoftime1 evidently wasn’t selective enough, as Rosy the Octoling had found that 4 minors had been let in: CuteYoshiLover, TetraCaden, Genesis, and Namisina46. Technically, a total of 5 minors have ever been in the Lewd House, as Moka was invited by TCS (and persuaded to join by Peachy); however, Moka is only mentioned in passing as a minor in the server and doesn’t show up in any of the Lewd House screenshots directly.
CuteYoshiLover: she was already known to have been in the Lewd House because of TCS’s message and was 17 at the time.
(Lewd House Heist SFW Dropbox\Underage Historial\CuteYoshiLover\cuteyoshiloverage.png)

When both TCS and ghostofitme1 were asked about why CuteYoshiLover was in the Lewd House, both of them say that she wanted in and her birthday (New Years) was close enough, with ghostoftime1 saying it was a difficult decision. Interestingly, “Gummy” also brings up that Moka was in the Lewd House, but if so, why didn’t Moka say anything about this when she was there?
(Lewd House Heist SFW Dropbox\Underage Historial\CuteYoshiLover\cuteyoshiloverbeinginthelewdhouse.png)cuteyoshiloverbeinginthelewdhouse2.jpgcuteyoshiloverbeinginthelewdhouse3.jpgcuteyoshiloverbeinginthelewdhouse4.jpgcuteyoshiloverbeinginthelewdhouse5.jpgcuteyoshiloverbeinginthelewdhouse6.jpgcuteyoshiloverbeinginthelewdhouse7.jpg
(Lewd House Heist SFW Dropbox\Underage Historial\CuteYoshiLover folder)

TetraCaden: he was 17 when he first joined. His Twitter banner at the time even had his birthday listed, so it was kind of shocking that ghostoftime1 let him join in the first place.
TetraCadenAge.pngTetraCadenJoinDate.png
(Lewd House Heist SFW Dropbox\Underage Historial\TetraCaden folder)

Genesis: he was 16 in early 2019 (the message where he says his age was taken outside of the Lewd House), and Geof celebrated Genesis’s birthday on July 10. Genesis had joined once when he was 16, and again when he was 17.
genesisagebefore2019birthday.jpggenesisbirthdayproof.pnggenesisfirstjoindate.pngGenesisJoinDate.png
(Lewd House Heist SFW Dropbox\Underage Historial\Genesis folder)

Namisina46: her true age (15) was made public as 15 when Geofcraze634 was exposed, and she was actually 15 (instead of the commonly-stated 14, even by me; oops) when she was in the Lewd House (joining right in the middle of an ERP session :story:).
Namisina46AgeProof.pngNamisina46JoinDate.png
(Lewd House Heist SFW Dropbox\Underage Historial\Namisina46 folder)

Had they been kicked out as soon as possible (given how relatively easy it was to find their ages), then at worst they would have been inadvertently exposed to pornography and ERP. However, not only were they exposed to said NSFW, but all of them except Namisina46 (and I guess Moka) had directly participated in ERP with other members of the server.
CuteYoshiLover (Emmychan) had her own room, ERPed with TCS and ghostoftime1, and had participated in sending porn.
TCScuteyoshiloverDisgustingERP3.pngTCScuteyoshiloverDisgustingERP1.pngTCScuteyoshiloverDisgustingERP2.png
(Lewd House Heist SFW Dropbox\TehCanadianSpartan folder)

Ghostoftime1CuteyoshiloverERPshit1.pngGhostoftime1CuteyoshiloverERPshit2.pngGhostoftime1CuteyoshiloverERPshit3.pngGhostoftime1CuteyoshiloverERPshit4.png
(Lewd House Heist SFW Dropbox\Ghostoftime1 folder)

miscLHgrossNSFW2Censored.png
(Lewd House Heist SFW Dropbox\Miscellaneous\miscLHgrossNSFW2Censored.png)

TetraCaden was one of the most active members of the Lewd House, having his own room and directly ERPing with TCS, LizzieRatcicle, and Ellie Godelia. He also was invited to an ERP VC by Ellie, participated in the ERP voice channel as seen above, and ERPed in the VC’s respective chat channel.
TCSTetraWeirdShit1.pngTCSTetraWeirdshit2.png
(Lewd House Heist SFW Dropbox\TehCanadianSpartan folder)

LizzieAndOthersERPshit1.pngLizzieAndOthersERPshit2.pngLizzieAndOthersERPshit3.pngLizzieAndOthersERPshit4.pngLizzieERPlogAgain1.pngLizzieERPlogAgain2.pngLizzieERPlogAgain3.pngLizzieERPlogAgain4.png
(Lewd House Heist SFW Dropbox\Lizzie folder)

EllieTetraWeirdshit1.pngEllieTetraWeirdShit2.pngEllieTetraWeirdshit3.pngElliepreparingsuspiciousvc1.pngElliepreparingsuspiciousvc2.pngElliepreparingsuspiciousvc3.pngElliepreparingsuspiciousvc4.png
(Lewd House Heist SFW Dropbox\Ellie Godelia folder)

LHerpVC1.pngLHerpVC2.pngLHerpVC3.pngLHerpVC4.png
(Lewd House Heist SFW Dropbox\Miscellaneous folder)
In 2023, Ellie claimed that she still talked with TetraCaden and that he actually forgave her for her actions in the Lewd House, as TetraCaden allegedly admitted he shouldn’t have done the ERP.

Ellie:
I still talk with the guy - he’s of age now, obviously.

Delta225:
Yeah.

Pineapple:
Mhm.

Ellie:
And uh- I actually apologized to him, and he actually said it was cool. Like he was fine with it, like, he’ll admit he shouldn’t have… you know, did those roleplays with me and he felt… awful about it, but, we decided to let bygones be bygones and yeah, we still talk, actually.

The only text evidence screencapped of Genesis’s ERP was with Geofcraze634, who joined with him and proceeded to role-play a make-out session.
Geofjoinsthelewdhouse1.pngGeofjoinsthelewdhouse2.pngGeofjoinsthelewdhouse3.pngGeofjoinsthelewdhouse4.png
(Lewd House Heist SFW Dropbox\Geofcraze634 folder)

Geof had made a somewhat suggestive SFM poster of Genesis’s character in a swimsuit, but other than interacting with him, he barely did anything that incriminating in the server and had left in August 2019, according to Rosy the Octoling.
(Lewd House Heist SFW Dropbox\Geofcraze634\geofmakingnsfwofgenesis.png)
Lewd House Heist SFW Dropbox\Geofcraze634\Note #04.txt said:
Geofcraze634 left the Lewd House around August. According to our guy inside the server there is barely any material against him in the server, aside of the Genesis stuff.

There aren't any screenshots of messages indicating that Namisina46 ERPed with anyone, but Ellie did send a NSFW poster of her character.
(Lewd House Heist SFW Dropbox\Ellie Godelia\EllieGrossNSFWshit4Censored.png)

When TCS was with Peachy, he apparently left the server at first, but rejoined later with Peachy after ghostoftime1 told him to stop being “so God damned paranoid.” TCS would then later piss off Peachy by (presumably) ERPing with “Ghost”, which could refer to either ghostoftime1 or “Ghosty,” another person in the Lewd House separate from ghostoftime1 and LizzieRatcicle’s boyfriend at the time.
tcsrejoinsthelewdhouse1.jpgtcsrejoinsthelewdhouse2.jpgtcsrejoinsthelewdhouse3.jpgtcsrejoinsthelewdhouse4.png
(Lewd House Heist SFW Dropbox\TehCanadianSpartan folder)

Rosy the Octoling screencapped all of this and aided the Seven Deadly Boomers with compiling it into a Dropbox. As what was going on in the Lewd House started to leak, Ellie had heard her nudes were about to be leaked, so she posted herself in her underwear on Twitter (funnily enough, mirroring Heavy the Squid).
(The Lewd House Continues: Your Favorite Splat-tubers are Scumbags, 4:30)
(TehCanadianSpartan - Going Full Circle, 14:11)

According to the Splanimations Archives article, the Dropbox was made public around a month later, on October 27, 2019. Apparently, TCS left again before the Dropbox dropped.
(Lewd House Splanimations Archive article)

The biggest names involved (ghostoftime1, Geofcraze634, LizzieRatcicle, TehCanadianSpartan, and Ellie) all make apologies on their social media.
ghostoftime1 posted his apology on DeviantArt on the same day the Dropbox came out, confirming that yes, he and LizzieRatcicle were involved and there were minors in said server. He had let CuteYoshiLover (Emily) and TetraCaden in because they were 17 and close to 18, while he initially didn’t know the ages of Namisina46 and Genesis and claims he kicked them out as soon as he learned they were underage.
(The Lewd House Continues: Your Favorite Splat-tubers are Scumbags, 1:47)
My attempt at transcribing the first 3 paragraphs said:
I would like to address the recent drama that has been going on in Twitter. Regarding the whole Lewd House and the involvement of Clauds and myself… they are unfortunately true.

And that includes the involvement of certain underaged individuals, Emily, Nami, TetraCaden, and Genesis. Regarding Nami and Genesis, I was initially unaware of their underaged status. As soon as I learned about it, I had them removed.

As for Emily and Caden, they really wanted to join the server, under the reasoning that they’d turn 18 in the near future. In all honesty, I should not have bothered. But I did…

Namisina46 did admit she lied about her age when talking to TCS, so I believe ghostoftime1 when he says he didn’t know about her age at first. However, it’s not clear if ghostoftime1 kicked her out after finding out her true age, or if she left on her own (as implied by A Polish Guard in his video on the Lewd House).
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\TCS' Weird DMs\Namisina46 (Minor)\Full Chatlog [NSFW]\Direct Messages - Namisina46ST [574628815469281330].html)(The Lewd House Continues: Your Favorite Splat-tubers are Scumbags, 2:07)
My transcription attempt said:
But he has lied about kicking them out. Genesis did leave the server, but came back later. As for Nami, she left on her own.

However, even if ghostoftime1 was honest about kicking Genesis the first time, Genesis later rejoined (with Geofcraze634).
genesisfirstjoindate.pngGenesisJoinDate.png
(Lewd House Heist SFW Dropbox\Underage Historial\Genesis folder)

Of course, this leads to the obvious question: how did these minors learn about the Lewd House in the first place? When asked, ghostoftime1 dodges the question and claims to not remember how one of the minors (CuteYoshiLover) found out, while also saying that she approached him directly.
(The Lewd House Continues: Your Favorite Splat-tubers are Scumbags, 2:40)
My transcription attempt said:
I don’t remember how Yoshi found out either. But she approached me directly.
I was honestly surprised she was that way.
Later in the Discord group chat, ghostoftime1 makes some more interesting DMs, but since they aren’t specifically about the Lewd House, I put them here.
(The Lewd House Continues: Your Favorite Splat-tubers are Scumbags, 2:51)
My transcription attempt said:
jokeroftime1:
At the same time, though you guys just seem to really want to eliminate us for whatever reasons.
Yeah. We’ve made some huge mistakes, I’ll concede that much
But that doesn’t mean we’re going to drop off the face of the Earth just because you all want us to.
Frankly, Clauds and I in particular are just done and tired of all of this and just want it to stop.
Honestly, what gives you guys the right to meddle in ANYONE’S business?

Ishi:
Are you really asking that?

jokeroftime1:
Yes, I am.
Cuz I’ve seen the jobs you guys pulled.


(The Lewd House Continues: Your Favorite Splat-tubers are Scumbags, 3:03)
My transcription attempt said:
jokeroftime1:
Scott is right, we can’t (unreadable) mistakes of the past.
But we CAN learn from those mistakes.

Ishi:
Most of you don’t.
Clearly

jokeroftime1:
You don’t know us that well.

Ishi:
I know more than enough to know that you people don’t learn.

jokeroftime1:
You’re an outsider making petty assumptions.

Ishi:
Your fanbases are soft and delusional
It’s easy for all of you to say whatever, they’ll simply fall for it.

Flying Scott:
(replying to “You don’t know us that well.”) Funny.
Hasn’t Ellie been sexually violated or something akin to that when she was 16 with (unreadable)

This one is just the above one starting at “You don’t know us that well” which includes an extra message by Flying Scott. I didn’t bother attempting a transcription because it was becoming more effort than it was worth, and I only included it for completeness.
25.3 extended.png
(The Lewd House Continues: Your Favorite Splat-tubers are Scumbags, 3:15)

(The Lewd House Continues: Your Favorite Splat-tubers are Scumbags, 3:22)
My transcription attempt said:
jokeroftime1:
Maybe not. But it doesn’t change the fact that you’re all a bunch of assholes desperate for attention and clout.
(unreadable)
ghostoftime1 only states that she requested to join and he “allowed” her in.
cuteyoshiloverbeinginthelewdhouse4.jpgcuteyoshiloverbeinginthelewdhouse7.jpg
(Lewd House Heist SFW Dropbox\Underage Historial\CuteYoshiLover folder)

It’s possible that Ellie may have been the one to tell CuteYoshiLover about the Lewd House. According to Ellie, ghostoftime1 told her to invite as many adults as she could (which seems out of character for someone who was “selective” about who joins) and Ellie sent an invite to CuteYoshiLover, legitimately thinking she was an adult. Ellie says she doesn’t remember if anyone accepted her invites, and when she realized her mistake, she didn’t say anything to avoid making ghostoftime1 and CuteYoshiLover mad.

Ellie:
I will admit, I did send a few invites, but I don’t know if any of them accepted mine. I will admit I did send one to Emily [CuteYoshiLover], but I don’t know if she accepted one or not, because… I believe it was… ghost[oftime1] who asked me to send one to her-

Pineapple:
Hmm… that’s intr- alright, that is intre-

Ellie:
I mean, I- I don’t know, I might be wrong, but from what I remember personally, ghost[oftime1] just told me to send as many invites to those who were of age, and I legitimately thought Emily [CuteYoshiLover] was of age at that time. But, then I realized, “wait, isn’t she a minor?” That was at that moment I began to question things, but I didn’t think of much about it at the time because I didn’t wanna, you know, make ‘em upset because: 1, you know how Emily [CuteYoshiLover] clearly is, and 2, I’m sure you’ve seen how ghost[oftime1] is, I mean- [...]

While being interviewed over Discord about the Lewd House, Skylar claimed that both ghostoftime1 and Ellie sent an invite to CuteYoshiLover, but Ellie sent hers to CuteYoshiLover first. CuteYoshilover accepted Ellie’s invite, then guilt-tripped ghostoftime1 into staying.
(A Lesson On Who To Trust, 22:52)

However, after Skylar invites CuteYoshiLover, CuteYoshiLover states that she forced ghostoftime1 to invite him.
(A Lesson On Who To Trust, 38:04)

ghostoftime1 claims CuteYoshiLover was about to throw a tantrum for not letting her in (which to be honest seems to be phrased manipulatively), while Skylar presses CuteYoshiLover again, recieveing the same answer but more unsure.
(A Lesson On Who To Trust, 39:07)

Skylar claims that CuteYoshiLover told her she accepted the invite from Ellie, and gets mad. CuteYoshiLover leaves the group chat at this point.
(A Lesson On Who To Trust, 40:06)

The interviewer, Delta225, asks ghostoftime1 for any evidence, to which ghostoftime1 provides chats of Steam messages. In these Steam messages, ghostoftime1 seems to take advantage of CuteYoshiLover’s poor memory of the Lewd House to make her admit to “guilt-tripping” him.
(A Lesson On Who To Trust, 41:54)(A Lesson On Who To Trust, 41:54)(A Lesson On Who To Trust, 44:25)(A Lesson On Who To Trust, 44:25)

ghostoftime1 also sent another screencap of a DM (on DeviantArt?) from Skylar asking if CuteYoshiLover guilt-tripped ghostoftime1, to which CuteYoshiLover says “I admit…”
(A Lesson On Who To Trust, 47:42)

Skylar returns, but unfortunately cannot find the evidence of CuteYoshiLover saying that Ellie invited her in.
(A Lesson On Who To Trust, 49:39)

Skylar sends Delta225 a friend request to show him DMs proving that Emily was lying, but they are just Discord DMs during when CuteYoshiLover said in the group chat that she thought ghostoftime1 invited her.
(A Lesson On Who To Trust, 1:01:13)(A Lesson On Who To Trust, 1:01:38)
TL;DR: In the original Dropbox images, ghostoftime1 never outright states he invited CuteYoshiLover, only that he let/allowed her in. Ellie, ghostoftime1, or possibly both of them sent CuteYoshiLover an invite to the Lewd House, and it seems more likely that CuteYoshiLover took the invite from ghostoftime1, as the credible evidence seems to point towards that. CuteYoshiLover probably did beg to join, but not to the extent of how ghostoftime1 paints her in his “evidence.”

Anyways, back to “now,” Geofcraze634 had made his apology on Twitter around the same time as ghostoftime1.
(The REAL Issue with SFM/Gmod Community, 1:04)

LizzieRatcicle had made her apology after ghostoftime1 on DeviantArt, on November 1, 2019. I guess when Genesis rejoined he didn’t do anything past that initial RP with Geofcraze634, as LizzieRatcicle’s excuse was that she was either “asleep” or “wasn’t paying attention.” She also states that both CuteYoshiLover (Emily) and TetraCaden “begged” to join.
(Shit been going on and an apology to my friends)

TehCanadianSpartan made his apology mid-November. He then later made an update video (unfortunately deleted) where he claimed the apology didn’t matter to some because his “opinion is invalid” and “free speech is dead” :story:
(TCS's Tweets about the Lewd House, screenshot taken from Why Are Splatoon YouTubers So Bad At Apologizing?, 0:15)

TCS:
I released an apology on Twitter, but it won’t matter to certain people, because my opinion is invalid and free speech is dead.

Ellie seemingly made an apology at around the same time, as Flying Scott says it’s bad (but doesn’t show it) in the same video talking about everyone’s apologies for participating in the Lewd House. The following screenshot may be the mentioned apology, as it is similar to the others’ apologies and Flying Scott’s criticism apply to it.

Flying Scott:
Ellie Godelia goes and makes the same point as Spartan, that being, “I feel horrible because I got caught.”
(To Catch a Squidette, 6:54)

According to A Polish Guard, after this apology Ellie allegedly gave control of her server to Bronies to “protect Ellie and her friends’ mental health” :story:

Ellie’s “apology” on the matter was just as vapid as the rest of the guilty people
She’s only sorry she was caught
The reaction Ellie has been having, however, is something to take note of
Ellie apparently gave control of her server to a group of Bronies (No, I am not kidding)
They’ve basically turned it into a super secure hugbox to “protect Ellie and her friends’ mental health”
It’s pretty funny that for someone who has says this is a big misunderstanding and that she “learned from her mistake,” she sure does seem to be acting pretty guilty

Ellie later posted a statement about being in the Lewd House on Twitter (A) at the start of 2020. While she admits she should have been careful with who she ERPed with, she mainly complains about getting a lot of hate for being in the Lewd House (and ERPing with a minor, which isn’t not mentioned), and says that the hate should be directed towards Lewd House creators ghostoftime1 and LizzieRatcicle. Quick reminder that Ellie’s initial rise to fame was for exposing Heavy the Squid for ERPing with a minor.


As stated by the Splanimations Archive article on this event, this was the straw that broke the camel’s back for many, and caused many people to either leave SplatSource or not rejoin.
(Lewd House Splanimations Archive article)

In the fallout of the Lewd House being revealed, some of the big names involved continued to get exposed. While the Seven Deadly Boomers exposed Jacktropolis, they also hijacked TCS’s Discord account. They collected incriminating Discord messages from November to December 2019 and compiled them into a Dropbox, which released January 24, 2020.
TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\A message from The Seven Deadly Boomers.txt said:
As you may have guessed, we may have gotten into TCS's account. These are all the incriminating, fucked up, messages we may have scrapped off his account. Most screenshoots were taken around November and December.

Flying Scott:
Aight, so another Dropbox was released on the twenty… fourth of January, 2020.

Relevant to the Lewd House, TCS was talking to Namisina46, who both knew there were minors in the Lewd House and didn’t say anything. They both knew it would have been a big scandal, so TCS had planned to leave with Peachy sometime in mid-August. TCS also reveals that after he rejoined, Genesis left on his own by August 18, 2019.
Announcement_Foreshadowing.pngHush_Hush.pngForeshadowing_2.pngAknowledging_Emily_Moka.pngHUGE_FORESHADOWING.pngForeshadowing_ Aknowledge.png
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Continuation of Lewd House\Aknowledging minors folder)

In addition, when the original Lewd House Dropbox was made public, TCS talked to fellow Lewd House members Geofcraze634 and LizzieRatcicle about the public reaction.
Geof_Insincere.pngIndirectly_Proving_The_Evidence_was_real.png
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Continuation of Lewd House folder)

When A Polish Guard made his video on the Lewd House, TCS got his friend Broadside to report the video and his friend Noctis to mass report Rosy the Octoling’s Twitter alt.
tcs_broadside_mass_reporting_3.pngtcs_noctis_mass_reporting_11.pngtcs_noctis_mass_reporting_10.png
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Mass reporting saga\TCS Mass reporting folder)

There is more incriminating stuff about TCS, but since it’s not relevant to Lewd House, I’ll cover it briefly under a spoiler.
Namisina46 (minor) sent an image of her character cuckqueaning Peachy, and she participated in vore RP with him.
TCSNamisina46WeirdChat5.pngVore_With_Kids.png
TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\TCS' Weird DMs folder)

These DMs start with Octo Luna (minor, also the one to expose Minti with the help of Jacktropolis) telling TCS that someone named Nightmare_Rarity forced (presumably) ERP involving body-modifying potions onto her.
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\TCS' Weird DMs\Octoluna (Minor)\Full Chatlog [NSFW]\Direct Messages - Octo Luna [594692968254930950].html)

A little over 2 weeks later, Octo Luna had started some (E?)RP with TCS, which included the previously-mentioned potions. Octo Luna and TCS continued to ERP, with Octo Luna sending hentai.
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\TCS' Weird DMs\Octoluna (Minor)\ERP (3).png)TCSOctoLunaWeirdERP7.pngTCSOctoLunaWeirdERP4.pngTCSOctoLunaWeirdERP5.pngTCSOctoLunaWeirdERP6.png

(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\TCS' Weird DMs\Octoluna (Minor) folder)

With Skylar, TCS sent her an NSFW image of his Octoling OC, Skylar sent him some hentai, and TCS made a bondage comic where Skylar gets bound and sexually assaulted by TCS’s evil OC, NNH.
bruh.pngSkylarGrossHentai_CENSORED (1).png Skylar's Bondage Fetish (2).pngSkylar's Bondage Fetish (3).jpgSkylar's Bondage Fetish (5).pngSkylar's Bondage Fetish (6).pngSkylar's Bondage Fetish (1).pngSkylar's Bondage Fetish (3).pngskylarbondagefetish_CENSORED (1).pngSkylar's Bondage Fetish (1).jpg
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\TCS' Weird DMs\Skylar Karategirl [INCOMPLETE] folder)

The screenshots were compiled into a video by the Seven Deadly Boomers.

(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\TCS' Weird DMs\Skylar Karategirl [INCOMPLETE]\Attachments [NSFW, click at your own risk]\Kidnapped.mp4)
Despite him publicly telling his fans not to witch hunt people, in a private group chat he had his friends mass report Moka.
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Mass reporting saga\TCS Mass reporting\MassReportGroupchat.png)

TCS also sent Noctis a list of Twitter accounts belonging to everyone involved with the Peachy drama, telling him to report them for “targeted harassment.”
tcs_noctis_mass_reporting_5.pngtcs_noctis_mass_reporting_3.pngtcs_noctis_mass_reporting_4.png
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Mass reporting saga\TCS Mass reporting folder)
TCS was part of LizzieRatcicle’s Discord staff, and they had a separate group chat for each other. It was probably meant for discussing moderation decisions, but it became a porn sharing chat, including young-looking fictional subjects. At one point the group spent 3 days just sending porn to each other, in which a minor (Namisina46) was present.
1
42.2 3 days of porn (2).png
42.3 3 days of porn (3).png
42.4 3 days of porn (4).png
(All cropped from TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Lizzie's Staff Team Group chat\Chatlog Highlights\3 Days of Pornography - P2 (CENSORED).png)
Saving the most degenerate for last, Alpha Swan had an NSFW server similar to the Lewd House. TCS (along with fellow Lewd House members Madness, Ellie Godelia, and Geofcraze634) were a part of it. At least this time there doesn’t seem to be any minors. Starting off with the tamest thing here, Ellie and Geof roleplay eating cake and some text-only ERP between TCS and Skylar.
ellie the fat fucking pig.pngTCS-Skylar erp (1).pngTCS-Skylar erp (2).pngTCS-Skylar erp (3).png

Madness has a character accidentally drink a shrinking potion, to which the only way to become normal-sized again is through sex. Of course, Madness created some suspicious-looking NSFW GMOD posters to go along with it.
AlphaNSFWServerGrossShit1.png

Alpha Swan tried (and failed :story:) to get other members’ nudes.
alpha trying to get members nudes.png

Skylar did some incest ERP.
incest erp.png

“Oh, we broke up. Time to rape somebody else.” :story:
supposed erp rape.png

Two people engaging in vore rape ERP.
unconcious QUOTE ON QUOTE rape.png

ERP that includes sperm growth. I didn’t even know this was a thing. :stress:
weird ass kinks.png
(All of the above screenshots from the TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Alpha Swan’s NSFW Server\Chat Log Highlights folder)
In short: weird DMs (including ERP with minors); TCS made a group chat to mass report people; Lizzie’s Discord staff (which included TCS and a minor) shared porn with each other; and revealing the existence of Alpha Swan’s NSFW server with very degenerate ERP.

Geofcraze634 would also get into some trouble: a little under a week later, a person named Capcophony had supposedly gotten Geofcraze634 to admit to grooming Ellie in 2016, with (Geofcraze634 brushing it off as having happened a long time ago.

Al:
On January 30, 2020, a user o- on Discord named “Capcophony” made Geof- made Geof say something about him grooming Ellie in 2016 - which is fucking gross - and he fucking admitted it, er- in a DM! With a fucking minor.

Nothing strangely seems to have come out of that, but it may be due to the fact that around the same time, another now-deleted Geofcraze634 Dropbox came out showing that he was grooming another minor, Genesis (yes, the same minor that was in the Lewd House and was brought in by Geofcraze634).
Geof had first met Genesis on June 3, 2017, when Genesis was 15.
(An Excavation Of The Largest Scandal in Splatsource History, 3:33)

Despite promising to “happily welcome” Genesis when he turned 18, Geof didn’t wait that long to send him NSFW stuff.
(An Excavation Of The Largest Scandal in Splatsource History, 4:52)
(To Catch a Squidette, 15:59)(Reacting To Saucy Splatoon Role Plays, 8:10)(To Catch a Squidette, 15:57)(Reacting To Saucy Splatoon Role Plays, 5:23)(Reacting To Saucy Splatoon Role Plays, 2:38)(Reacting To Saucy Splatoon Role Plays, 2:31)(Reacting To Saucy Splatoon Role Plays, 7:23)(Reacting To Saucy Splatoon Role Plays, 9:51)

The most well-documented drama was with Ellie Godelia, unsurprisingly. One of Ellie’s IRL friends, Pristine, confronted Ellie about her involvement in the Lewd House. Pristine told Ellie that she would tell Ellie’s parents about her time in the Lewd House, to which Ellie threatened to sue her. On February 2, 2020 (according to the video containing the call), Ellie and Pristine would argue in a voice call over Ellie threatening to sue Pristine. Because I couldn’t find the original video containing the call, this audio file is stitched together from the surviving parts used in other videos.
(To Catch a Squidette, 21:26)(Ellie Godelia's Downfall PART 3, 16:12)

(From Content Crasher: Ellie Godiela, 6:52-7:37)
Pristine:
Well, Elizabeth. Are you going to go through with this?

Ellie:
What?

Pristine:
Are you gonna go throu- through- Are you going to go through with this?

Ellie:
Probably, if you keep- if you stop- if you'd- stop bugging the shit out of me!

Pristine:
Well right now, cause you just threatened me, you're gonna sue me, so…

Ellie:
You literally revealed all my private information! (referring to the fact Ellie was groomed by Heavy the Squid and Geofcraze634)

Pristine:
Private information that should have been revealed a long time ago!

Anonymous:
Ohhh (unintelligible)

Pristine:
You're gonna tell me that you getting groomed, and then you allowing pedophiles in the server is okay, really? And then you have the audacity to threaten me to sue me!

Ellie:
You literally threatened- (Pristine: Nah, nah, nah nah nah nah nah nah nah nah! Uh-uh!) You literally revealed my private information!

Pristine:
I- I gave your chance to- I gave- (Ellie: Yes you did, yes you did!) nah, no. I- I gave you your chance to speak. I’m tired of it. ‘Cause right now, if you were going to sue me, I will counter-sue you.

Anonymous:
I can’t have any more friends in prison, my friend.

Ellie:
I’d like to see you try!

(From To Catch a Squidette, 22:08-23:01)
AwesomeJCR:
We don't want to see anybody get imprisoned ov- over a stupid misunderstanding.

Pristine:
Nah, that's not a misunderstanding. (Ellie: Oh no, she wasn't misunderstanding-) A misunderstanding is real rude.

Ellie:
SHE intentionally tried to reveal all my personal- (in the background as Pristine speaks) my life, on social media, just so what, so you could get me banned?!

Pristine:
How did I intentionally try to reveal all your personal information, ask- actually, I was asking in that server what the hell was going on, and no one gave me answers, 'til someone finally had the audacity to step up to me, and say what the hell was going on! I never knew you were groomed from ages 15-17! I never knew you actually turned into a pedophile! So explain to me how in the hell I'm a bad person?!

Ellie:
You literally tried (Pristine: Nah, I'm not-) to reveal all my information to my parents (Pristine: I did, and I'm glad I did!), and you think it's okay to do that, without my consent?! (Pristine: I don't need your consent, child!) And you think it's okay to just basically- (unintelligible) them!

Pristine:
Child, I don't need your damn consent! I don't! (Ellie: Yes you do, that's my line!) No, I do not need your consent, trust me! Don't get it twisted!

Ellie:
They literally had to ask me if all of this was true, and I said no, because now, I literally have to make a new alliances because of you!

The call was leaked on May 23, 2020 by General Salty, which caused Ellie to release another apology for her involvement in the Lewd House a month later.
(To Catch a Squidette, 21:11)

Flying Scott:
What is important is that it sparked Ellie to upload an apology, as she calls it, her “Long-Awaited Apology.”
(Old Lewd House Splanimations Archive article (February 21, 2021))

Again, the full thing seems to be gone, so like the Pristine call, this audio file will be stitched together from the surviving parts in other videos. From what survives, Ellie talks about her time in the Lewd House and threatening to sue Pristine. In the “apology,” Ellie claims to not remember anything about the Lewd House itself. She is clearly not focused during this apology; not only does it sound unscripted, but at one point you can hear game sound effects while she’s talking. It also seems she recorded the whole thing in a Discord voice call, as later two people joined, with one asking to be censored.

(From To Catch a Squidette, 35:43-35:53)
Ellie:
I've been keeping quiet for so long, it's (Crush Crush sound effect) probably better to say it now, then later. I'm sure that's what you guys would have wanted in the first place (Crush Crush sound effect). You would have wanted to know the truth.

(From Ellie Godelia's Downfall PART 3, 17:10-17:54)
Public apology, Ellie:
(sigh) Like, I honestly should've done my research, like, there was this... one server, I think it- I believe it was an NSFW server, this happened like a long time ago. My memory is honestly foggy, because it's... I kind of honestly forgot. But I do know this, like, here's what I'm able to remember:

Apparently, there was a bunch of popular people there, well, not, uh popular- it was mostly popular... Splatoon... YouTubers from what I was able to gather. Not like Viantastic or uh... Gabriel Gaming or anything, like, no no no no no, I think it was just like, you know, animators. GMOD animators, from… what I remember... was it? Yeah, it was!

(From To Catch a Squidette, 19:33-19:57)
Ellie:
I think we only interacted a few times, I don't remember if we did anything, you know, sexual, but if we did, I do apologize to the person, you know, I've... sexualized, I mean, I really don't know how- I'm not trying to sound... blank, or you know, empty or anything, it's just... (sighs) like this happens so long ago it's kind of old, but at the same time, I don't wanna be bringing up, like, old stuff that's unnecessary.

(From To Catch a Squidette, 34:55-35:33)
Ellie:
The reason why I said it was because, uhm... uh... (Someone joins Discord voice chat) I said it because, like (another person joins) I was so... angry, and I think they said they were gonna release some information I did not want them to release, but-

Discord Friend 1:
What's up!

Ellie:
So-

Discord Friend 2:
Hello there Ellie!

Ellie:
It really, really, really gets confusing. I mean-

Discord Friend 1:
G'day! I miss more stuff in the community of Splatoon!

Ellie:
I think I forgot to mention that I was uhm- I'm in a Discord call, but, you know what? I might as well just get that out of the way, I mean I'm not trying to persuade anyone here, like...

Discord Friend 2:
If you- If you upload this, like, video, can you put my video on, anonymous?

Unlike past apology videos from this community, this was not received very well.

Flying Scott:
But where was I- ah yes, The comments. They are indeed quite special, for this marks the first time that I saw a Splatoon YouTuber’s apology video with an overwhelming amount of people not accepting the apology.
(Ellie Godelia's Downfall PART 3, 18:42)(Ellie Godelia's Downfall PART 3, 19:04)(Ellie Godelia's Downfall PART 3, 19:34)

One of Ellie’s former Discord staff, Link, makes a long comment responding to the apology (and helped me in figuring out the order of the surviving parts, thanks Link!). All of these negative responses cause Ellie to make the apology private, with her claiming that she “received more than enough feedback.”
(Ellie Godelia's Downfall PART 3, 20:08)(To Catch a Squidette, 39:14)

Despite trying to hide herself, the Seven Deadly Boomers recorded a Discord call where Ellie talks about the Lewd House drama for about an hour and 40 minutes, uploading it on July 9, 2020.
(Ellie Godelia's Downfall PART 3, 20:52)(Ellie Godelia's Downfall PART 3, 21:02)

Again, like the Pristine call and Ellie’s apology, I was unable to find an archive of the full call, so this audio file is stitched from what is used in Ellie Godelia’s Downfall PART 3. Ellie talks about TCS, Geofcraze634, claiming that she was lied to about there being no minors in the Lewd House, how she doesn’t really have friends in this community, and about how she made her apology video private.

(From 21:02-21:20)
Interviewer:
Wait, so, uh… so, you need to tell me that TCS sent, uh, nudes to a minor?

Ellie:
Um…

Discord Guy:
No- well, I don’t really know.

Ellie:
Well, since- well, actually, I- from what I gathered, yes, but, like I said, I don’t know. But don’t take my word for it.

(From 22:45-23:19)
Ellie:
Basically, I was in this NSFW server, and I was told that, you know, people there were 18+ only. However, they- they weren’t being honest with me and someone apparently who was there, was not 18+, they were actually 17. So…

Interviewer:
Really?

Ellie:
Yeah. So you know that’s… they pretty much not only lied to my face-

Interviewer:
So like, pretty much- (Ellie: But-) so pretty much like since, uh, you were involve- since you were- (Ellie: And-) since you in the channel, people think that you- you, you’re like a pedophile. Alright.

Ellie:
Yes.

(From 23:40-23:55)
Ellie:
I mean, I’m not trying to make an excuse or anything, I’m just saying this, like… when you think about it, like, when you first join a community, is- do you- is there even an instruct- instruction booklet of how to make friends? How to get known in the community? There isn’t.

(From 24:57-25:11)
Ellie:
I mean, I’m just saying this right now: I do regret the things I’ve done, but… (Interviewer: Kay.) I’m not gonna let that hold me down, I’m- (Interviewer: Alright.) I’m going to keep moving, and keep improving myself as a person.

(From 25:18-25:38)
Ellie:
They say mistakes are a way to improve yourself, like… it’s deep stuff like that, I really… (clears throat) I am not the best at explaining stuff, I… really-

(From 25:41-26:02)
Ellie:
I don’t know what to do. But at the same time… it’s feels like no matter what I say, I feel like I’m- called out for saying something like, “No,” you- like, I really don’t know how to explain this, but… I guess I just feel like I’m being gaslit everywhere, it’s-

(From 26:16-26:21)
Interviewer:
Geofcraze, right? I heard a lot of stuff about him. What’s that-

Ellie:
He’s my friend.

(From 26:29-26:43)
Interviewer:
Um, I heard a lot of good stuff, and bad stuff, about him [Geofcraze634]. I heard that he sent feet pics to random people, is that true?

Ellie:
Um… no, I think it was the other way around. Well, uh… (sighs) I don’t remember.

(From 26:46-27:05)
Interviewer:
But, apparently you just… made an apology video and didn’t delete it, I think.

Ellie:
Actually, it was privated, mainly because I received more than enough feedback. Like…

Interviewer:
So, you pretty much got, like, a lot of dislikes, and then you just delete the video.

Ellie:
No, I privated it. There’s a difference.

(From 27:19-27:43)
Interviewer:
Wait, so did you say that, uh, Geofcraze is still like one of your best- [friends?]

Ellie:
Course he is.

Interviewer:
Well, I’m- I mean, I heard about him, I heard that he was a good guy, that he’s cool and I heard about how people are trying to expose him… for petty stuff. I don’t know, I mean, what do you (Ellie: He’s-) think about that?

Ellie:
People are just gonna be dumb like that, but I can’t really-

(From 27:54-28:04)
Ellie:
I mean… (sighs) look, I know what I did was wrong, and I do deeply regret what I’ve done, but I’m not gonna mope around and let that haunt me forever.

(From 28:11-28:53)
Interviewer:
I would do a therap- I think you need to actually talk to some of your family members, okay, and just talk to your best friends, you know.

Ellie:
I don’t have any… ‘cause-

Interviewer:
Uh… lookin’ at your…

Ellie:
No, I’m talking about in real life! (Interviewer: Friends-) They…

Interviewer:
Well if you don’t have any in real life, then just talk to people on Discord, it’s- (Ellie: Some of those people told me to kill myself.) -like we’re telling you to do all these things, but you just refuse-

Ellie:
Do you ever think I have time to- single- look through every single person, when most of the time (Interviewer: Well, you don’t have to talk to everyone, they don’t have to- they don't have to talk to every single-) they say something, the stuff they say about me is the same? (Discord Girl: Ellie! Ellie…) “Go kill yourself! You need to leave!” (Discord Girl: That’s right, not- ahem!) That’s what they’ve been saying! That is not criticism, they’re just being blunt, and (Interviewer: I’m talking-) that’s not helpful!

(From 29:54-30:08)
Ellie:
(sighs) I’m not trying to fake any of this. I’m not trying to fake my memory loss, I just legit can’t remember everything, and there’s… only so much I can process before it gets too much, you know.

(From 30:21-30:38)
Ellie:
I mean- I… I would- I would love to talk to those people who are criticizing me, but… how is leaving the Internet, how is… how is killing myself going to solve anything?
As another strike against ghostoftime1, Ellie implies he was the one to lie to Ellie about the Lewd House having no minors in it.

Ellie:
However, from what I remember, I believed that everyone there was 18+ and up. Like, I’m not joking, I legit thought everyone there was above the age of consent.

Pineapple:
How does that work? Well, we can’t exactly dispute that, uh-

Ellie:
I know, I know, it’s just- (Pineapple: S-) I, was unaware that some people, in that group, were minors. And I even asked ghostoftime, if there were any minors in that group because, you know, the whole Heavy situation happened, and of course I wanted to be more careful now with that, but, my dumb ass believed that ghostoftime was telling the truth.

Ellie would then explain herself again on September 27, 2020, making some more statements about her involvement in the Lewd House, but this would be the last thing from her regarding the Lewd House for a few months.
(To Catch a Squidette, 7:11)(To Catch a Squidette, 14:19)

Ellie wasn't the only one who stayed silent, as the others also went quiet for a similar length of time. Aside from the few that stayed and tried to repair their image, the majority of the people involved in the Lewd House eventually left the Splatoon community or the Internet altogether (if you’re curious, check out this post). The Lewd House is also an unfortunate case of grooming victims potentially becoming groomers themselves and continuing the cycle.
 

Attachments

Last edited:
Post Lewd House​
Lewd House Reinvestigation
Regarding the Lewd House, things stayed quiet until mid-March 2021, where CyndaFan announced that a group called “The Lewd House Commission Report” re-opened an investigation into the Lewd House and its participants (A).

Some people, like the Sentinel Simp Coalition, had their concerns (A) that the investigation would be too biased towards the adults exposed in the Lewd House. They also were suspicious that CyndaFan (the original writer for the Lewd House wiki article) had the “Ellie’s Trusted Friends” Discord role. While that isn’t explained, CyndaFan clarified that he joined Ellie’s server to interview her (this will be touched on later).

To make sure any “false” information on then-current Lewd House article wouldn’t cause any more damage, it was temporarily wiped until the investigation could finish.
(Lewd House Splanimations Archive edit history)(Old Lewd House Splanimations Archive article (March 12, 2021))

Part of this investigation was to get interviews with the people involved, so as mentioned before, CyndaFan joins Ellie’s Discord server and sets up an interview with Ellie on April 13, 2021. When something comes up, CyndaFan tells Ellie he’s not ready to start the interview, which causes Ellie to crash out.
(To Catch a Squidette, 7:11)

Ellie then pulled another suicide attempt, having the people in the group chat choose between her overdosing on pills or stabbing herself. She allegedly sent a pic of both, making it seem like she wasn’t lying.
(To Catch a Squidette, 40:50)(To Catch a Squidette, 40:56)

They all got in a voice call, where the other members begged Ellie to not kill herself. Like other bits of Ellie audio, I couldn’t find the full thing, so this audio file will be spliced from what survives in MediExcalibur2012’s To Catch A Squidette video. (VOLUME WARNING IN THE BEGINNING)

(From 40:59-41:05)
Discord Friend 1:
STOP! STOP!

Gmanluigi (I’m assuming this person is him based on the previous Discord message screenshots and watching a 2021 video of his):
Ellie, please, put the knife down!

Discord Friend 1 (tearing up):
Ellie, stop, Ellie!

(From 41:11-41:18)
Discord Friend 3 (with Discord Friend 1 crying in the background):
Do you hear these people? Do you hear them?

Gmanluigi:
Don't you know who you're affecting by doing this?

(From 41:34-41:39)
Discord Friend 1 (crying):
Please, Ellie, Ellie pl- wait...

Gmanluigi:
Ellie, put the knife down.

(From 41:45-44:06)
Ellie (with Discord Friend 1 crying in background):
I just don't know what to do anymore, man, I'm honestly... in my fucking end! I've tried, believe me, I've tried! But at this point, I don't know if I can do it any more! I (Discord Friend 1: No!) could've made, probably 7 million dollars doing God knows what else, I could've- I could've been talking to more people, I could've... been doing… something more productive with my life! But (Discord Friend 2: Ellie-) no! There’s (Discord Friend 2: Ellie-) no such thing as hope, is there?

I just feel like there's no- there's no one here, in this cold, cold wasteland. I have mental problems, bigger than anyone- any one of you can compromise. Or understand. Or handle, for that matter. I'm broken! Two sides of the blade. One rusty. One shiny. What's (AwesomeJCR: Just- don't-) the difference when it's just me and the blade.

Discord Friend 1:
Ellie, don't DO IT!

Discord Friend 3:
Don’t do anything-

AwesomeJCR:
Just don't… do anything… with... the knife!

Ellie:
I'm- I'm just- I'm just talk- I'm ju- I'm not... doing anything with the knife. I'm just thinking metaphorically, ‘cause one side I feel rusty, the other side I feel shiny, (Discord Friend 3: M'kay, okay, okay), and I feel like I'm feeling the rusty side right now. I am honestly at my limit. I'm tired (Discord Friend 3: Mhm, and you-) of waiting- (Discord Friend 3: I know.) I just feel like at this point, no one wants to be honest with me, no one wants to tell me anything, and people just hide stuff from me all because of the stupid stuff I did! I know I fucked up! I'm referring people that don't seem to understand my true pain, like Zeldaboy.

He never understands me. And I feel like all he really wanted me for was just for- body, not with, heck. And at the- at this point, considering how many scars I have on my body, (Gmanluigi: What?) why would anyone want to hang out with someone like me? I'm not attractive, I don't have a model figure, it's (Discord Friend 3: Don't let that be your perception of... things.) not just the fact that I look at myself in the mirror and I'm like, "Damn, who would wanna hang out with some... unattractive blob like that? It's also the fact that, what I've done! I literally roleplayed with a fucking minor! You know (unintelligible)?

Discord Friend 1: Yeah, and you're not the only one, Ellie!

When interviewed about it a few years later, Ellie claimed that this was a genuine attempt to kill herself.

Pineapple:
Was this another cry for help, another bait of sympathy, or was this genuine? Like, were you genuinely-

Ellie:
It- it was genuine. I can assure you, that one was genuine.

In the same interview, she would also claim that it was a cry for help.

Delta225:
So…

Pineapple:
Um… DjSwaggy is saying this [the suicide attempt being a cry for help] is a lie, care to respond?

Ellie:
Uh, it wasn’t. It literally was a genuine cry for help.

Obviously CyndaFan couldn’t get an interview with Ellie then, so he tried again on July 8, 2021 and managed to get an interview with Ellie. Again, I couldn’t find it in its entirety, so I combined the surviving parts into 1 video. Ellie admits to ERPing with TetraCaden, swears on her honor she won't fake more suicide attempts, and says she wants to be “worshipped for honesty, not for the terrible stuff” she’s done.

(From To Catch a Squidette, 19:05-19:33)
CyndaFan:
You'll see that I have saved here photos that were in the initial Dropbox, of Ellie and TetraCaden engaging in some interesting activities. And do you confess that everything in these images are real, that you interacted with TetraCaden in this manner?

Ellie:
Yes.

CyndaFan:
Alright.

Ellie:
I did, in fact, roleplay with TetraCaden.

CyndaFan:
And acknowledge that you knew, at the time he was a minor?

Ellie:
Yes.

(From To Catch a Squidette, 41:18-41:35)
CyndaFan:
...the night of 2018, where you... faked... your own death

Ellie:
I am sorry, for what I have committed, and I, swear, on my honor, for anything really, that I, am not going to do it again. You have my word.

(From To Catch a Squidette, 41:34-44:51)
Ellie:
I don’t want anyone getting involved in something so petty that I’ve done, just because they’ve worshipped me in that way. I want to be worshipped for honesty, not because of all the terrible stuff I’ve done… sh- should I? I probably shouldn’t have said that, can we cut that?

After this, the article was rewritten with new info from the “Lewd House Comission Report" For some reason, the new article on the Lewd House (one of the first things you see if you search up this event) says LizzieRatcicle was “not documented to have had any interactions with minors” in the Lewd House, which doesn’t seem to be correct based on what's in the Dropbox.
(Lewd House Splanimations Archive article)
LizzieERPlogAgain1.pngLizzieERPlogAgain2.pngLizzieERPlogAgain3.pngLizzieERPlogAgain4.png
(Lewd House Heist SFW Dropbox\Lizzie folder)

The following month, the previous savior of Ellie and exposer of Heavy back in 2018 MediExcalibur2012 makes a video titled “To Catch a Squidette - A WARNING about Ellie Godelia / Savannah Moscalla” collaging her behavior from the Lewd House up until now. While most of this video is used throughout the OP, some of the Ellie-specific stuff is covered in this post in the thread.


It’s quite interesting how the Lewd House scandal mirrors the Heavy the Squid scandal, with leaked underwear pics and Ellie faking her suicide upon a follow-up investigation. While this is the last of the Lewd House, this will not be the last time Ellie Godelia gets into controversy or is mentioned in this OP.

There are also some interesting stories, one during and two way after the Lewd House, that are interesting but don't warrant their own section.

InkyxKitty and AxolLobsterLord
On May 18, 2020, AxolLobsterLord, would tweet out that he was taking a nap. This would end up being his final Tweet at the time, as AxolLobsterLord would supposedly pass away due to lung cancer complications. Many people in the community would express their sorrow and send lots of positive messages towards AxolLobsterLord.
(Splatoon Twitter Drama - InkyxKitty, 2:24)
Love sent towards AxolLobsterLord

Early in the morning the next day, InkyxKitty’s mother supposedly went on to her Twitter account and tweeted out a link to a Google Doc, shockingly stating that InkyxKitty had committed suicide.
(Splatoon Twitter Drama - InkyxKitty, 3:46)(Splatsource_Dirty_Secret.zip, 15:01)

Something was off about this announcement; after all, it seems pretty odd that:
  • A mother would have access to her teenage child’s phone quite soon after said child’s passing
  • The mother types up a Google Doc and puts a link to it in the Tweet instead of simply tweeting out that InkyxKitty committed suicide
  • The mother created a hashtag meant to be spread around
  • The mother uses emojis, both in the hashtag and to sign off the Google Doc
  • The mother used InkyxKitty’s Google account to make the Google Doc, which (most charitably) implies that the mother typed it out on InkyxKitty’s phone
    • (Splatoon Twitter Drama - InkyxKitty, 4:08)
There was also this leaked Discord DM from InkyxKitty, which drama commentators used as proof it was fake. However, the attention comment seems more related to relationship drama (“I got the attention I wanted from him and broke up with him) rather than from the suicide attempt.
(Splatsource_Dirty_Secret.zip, 15:30)

Anyways (as you may have already guessed) it was fake. 3 days later, on May 22, 2020, InkyxKItty would tweet out that her mom forced her to do it for attention. She also brings up AxolLobsterLord unprompted, which kind of implies she did / was forced to do it as a result of the positive attention that AxolLobsterLord got.
(Splatsource_Dirty_Secret.zip, 14:50)

She would also tweet out a DM from a Twitter account telling her that she “deserves to die” and should “get raped” for faking her suicide. This account may or may not be a sockpuppet (A), coming from a user who has a history of making alt/sockpuppet accounts.
(Splatsource_Dirty_Secret.zip, 14:51)(Image 3 in Tea With Caramel's Tweet)(Image 4 in Tea With Caramel's Tweet)

What makes this even better is the day after, AxolLobsterLord came back and released a Twitlonger (A), because it turns out he also faked his death (with the help of MadisonSFM_Artz), as a “test” for the community! :story:
12
Words cannot express the amount of guilt an regret I have

Okay... Welp
Not sure how to excuse this one, because there isn't a reason to!
No, I'm not dead (as you can see...)
I'm just going to explain myself but first explain about my condition, because even I had no idea what I had (it is a form of lung cancer still, unfortunately-) I had to BEG my parents to tell me what I have and uhh... Yeah

Alright, so basically when I was in my real mother's womb (I'm adopted) she smoked a lot (that still holds true) but what I didn't know is that I was born 3 weeks early than when I was supposed to be due, why?
Because smoking while pregnant can cause babies to be born before their due date, and I unfortunately was born 3 WEEKS before I was due

It was also because of my mother's smoking, when I was born I had a cleft palate (thankfully) only on the roof of my mouth... And when I was about 11 months old I was able to get treatment for my palate

So many issues had come from my real mom smoking when pregnant with me right off the bat, being born 3 weeks before your due date can impact you

I've been told I'm a smart kid, but that's only because I've worked my butt off on studying almost all the time, my brain had a hard time developing at a young age, eating and breathing wasn't easy either (mind you I don't even remember any of this because I was under the age of 4, and I'm only now finding out about all of this, I have NO idea why they never bothered to tell me the truth, did they think I couldn't handle it?!
Or that it'd scare me further because of my physical status atm?)

My real parents found it to be a complex job in raising me because I already had so many issues, and yet like what, 1-2 years after I was born they decided to have another child? I'm not sure if my real mother decided to smoke while pregnant with my brother, but when I met him they didn't mention any health problems, same with Kayden

Anyways, skip some time forth to when I was 4, I always believed that my real mom and dad put me up for adoption because of financial issues... But learning about more of this, and how much they struggled with me, they also put me up for adoption because I was too much to handle, and I was complex to take care of due to having struggles of eating and (you guessed it) even breathing, along with struggling to learn because of my brain development issues.
So from then on I was raised by my adopted parents that I love very dear to my heart... Anyways, I also didn't exactly have the easiest time talking, my pronunciation on some words was really bad due to that stinkin cleft palate

My adopted parents faced a lot of obstacles with me.. Working with my eating difficulties, breathing wasn't as bad at the time, it wasn't very noticable. But my parents did notice I'd tend to get sick easily, which explained to why they were so scared of taking me to the hospital during this quarantine..

I got held back in 3rd grade, it's funny because I'd always say it's because of memes (it was mostly to cope with the frustration I had from being held back) but truly I just really struggled... Being introduced to multiplication was really hard for me, and to be honest? I've had a lot of emotional breakdowns in my younger years because I was so frustrated in why I had such a hard time in learning at school, I also got bullied for it too because I struggled with learning, I felt really low at that time

If it weren't for my adopted parents' determination I don't think I'd be the person I am today, and I could only imagine what else would've happened to me, it was also during this time they were my heros.. They really gave me the advice I now share today, they were the light to my darkness

I was just really inspired by them, they taught me well and told me that kindness is key, two wrongs don't make a right, etc. They inspired me to become the person I am today

To skip onto some inspiration people already know, it was of last year I met my siblings, but it was also the same year they had passed away, my sister passed away in a car accident, my brother took his own life

It was also at this point I really started to feel as if my breathing issues were growing worse, and I felt crappier and crappier.. I was then diagnosed with Lung Cancer, and as you could imagine my parents kept away the information from me, I did my own research and saw something called "smell cell lung cancer" which I believed I had for a long time because it mentioned something with smoking, but now that I finally know it's NSCLC (Non-small cell lung cancer) which can occur in smokers AND non-smokers, and what I do know is I'm on stage 3

But to put all of that aside... There is no reason to excuse for what action I have done, absolutely nothing, though I will say I DID want to test the community, and this is how I did it... Which was the stupidest decision I have ever made and I don't understand why even I would have thought this was a good idea, I know I'm going to be accused of wanting clout, but that's something I don't care for and I never will. I wanted to see how the community would be able to move on if one of their positive supporters disappeared, and uhh... Wow... I'm shocked, it's a mixed bag, I cried because even I didn't know how much people would be upset over this, and it hurts me to think I've upset so many, especially my dear Hydro... I mean it would've been obvious, but I should've told him my idea besides Maddy, speaking of her... I told her to do this. Maddy I want to say I'm so sorry, I risked your reputation over this, I don't expect forgiveness, heck from anyone really. Because it's all on me and I understand that.

This whole thing was such a foolish thing of me to do, but I will address this: yes I did indeed take a nap, no I didn't die, but yes I was sent to the hospital because I later woke up coughing, I thought I was just coughing up saliva until I tasted it and opened my eyes only to see it was blood, I had a panic attack and my parents did indeed come rushing in, and my mother immediately called 911 while my dad was with me trying to comfort me telling me everything was going to be alright... I feared for my life at that point.
I was stuck in the hospital for the whole week

I've also gotten some treatment upon my lung cancer, I had some of it removed because I'm in stage 3 and I have to have it removed bit by bit...

Anyways... Back to what I was talking about, I'm a fool, and I know an apology isn't enough to fix for the actions I have committed...
I'm 15 years old, I should know better. I know I've had my struggles in my brain development but I won't use that as an excuse for what I've done

I could've found a better way to test the community, and this sure wasn't it... Words cannot express how sorry I am

Even then, if something happens to me later on down the road, I don't want Maddy to talk about it on Social media, at least not right away, because matters like this should be handled irl, the media isn't important at that time

This test was messed up, every bit of it, and to see this place crumble because of so much emotional impact in the community, I want to set things right, but right now I want to give myself a break, this week was tiring enough for myself as well, I'm going to check on Maddy, and just give myself a break as well... Because I need to think over my decisions

I have so much regret and I don't know why I thought this would be a good idea

I love you all, I truly do. And doing this to you all wasn't right, I understand if I get backlash for this, because there is no valid excuse

I don't know when I'll be back myself

Stay Strong, my loves
(AxolLobsterLord TwitLonger)

Around a month later, InkyxKitty asked her Twitter followers if she should leave or not, with the majority telling her to leave.
(Splatsource_Dirty_Secret.zip, 15:14)

One of the replies mentions that InkyxKitty faked her own death, to which InkyxKitty repeats her alibi that her mom forced her to fake a suicide announcement.
(Splatsource_Dirty_Secret.zip, 15:35, only InkyxKitty's Tweets surived (under InkyxKitty repeats alibi))
Only InkxKitty’s Tweets survived, in order:
“it was my mom”/A
“then what should i do”/A
“photographic proof ??”/A

After leaving for a break, InkyxKitty came back on July 29, 2020, announcing that she came out as a non-binary lesbian after going to tele-therapy (A1, A2, A3).
InkyxKitty now lesbian
The following year (at the beginning of Pride Month), InkyxKitty came out as transgender and went by he/him (A).
InkyxKitty now transgender

A fake suicide be inspired by a fake death! Only in the SplatSource community :story:

TehCanadianSpartan Post Lewd House
As mentioned in the video about Skylar KarateGirl in the Jacktropolis section, by October 2019 TCS got with Skylar Karategirl. Unsurprisingly, like Peachy, this e-relationship also crashed and burned, with TCS being exposed for threatening and harassing her in late 2022 (A).


Specifically, TCS doxed her (told people Skylar’s full real name that was on her Facebook), posted a picture of a knife against his wrist, and allegedly asked Skylar to drug herself for his sexual pleasure.
(Doxxing Skylar\1.jpg)(Doxxing Skylar\2.jpg)(Heavy Trigger Warning\1.jpg)(Asked Skylar to drug herself for his own sexual pleasure.jpg)
(All of the above from the TehCanadianSpartan/TCS (Jordan Davis) [Mirror] Google Drive\Skylar Incident folder)

When confronted on it, he said he was going to get therapy and blamed Skylar because she apparently moaned in some voice call?
1.jpg2.jpg3.jpg4.jpg
(TehCanadianSpartan/TCS (Jordan Davis) [Mirror] Google Drive\Skylar Incident\Admitting to everything folder)

At the same time, TCS also got his YouTube channel terminated suddenly, causing him to try again and Tweet out his lament.
Breakdown Reaction.jpg
Cope.PNGGood, you don_t deserve it.jpgIn your dreams.jpglol.jpgThat’s sad coming from you.jpgUsing his self esteem excuse1.jpgUsing his self esteem excuse2.jpgUsing his self esteem excuse3.jpg
(All of the above screenshots from the TehCanadianSpartan/TCS (Jordan Davis) [Mirror] Google Drive\Skylar Incident\YouTube Termination Saga folder)

The new YouTube channel he is talking about is called DorQ, which just uploads random clips from various media and is completely divorced from Splatoon. It wasn’t hard to find this, as that channel is stated to be TCS in the description of the most recent video on a channel called The Object Gaming Network, a channel he was a part of and which used to be TCS’s gaming channel.
5 tcs most recent vid description.png

He didn’t stay away from SplatSource for long, as due to DemonJakie’s poor judgement (who would be exposed in a Google Drive later for general manipulation and degeneracy, which I wrote about in a post in this thread and in said Google Drive I found the TehCanadianSpartan/TCS (Jordan Davis) [Mirror] Google Drive (attached as a zip file of the same name)), TCS came back into the community in 2023.
IMG_5377.jpgIMG_5378.jpgIMG_5379.jpg
(Ashes to Ashes Google Drive\Ashlynn Being Responsible for Bringing TCS Back Into The Community folder)

This was a mistake, as he got into contact with then-minor FlutterCherryNM, then proceeded to send porn, send his dick pics, and talk grossly with her. He also may have exposed himself to a different minor.
IMG_4141.pngSPOILER_8FE6972F-A676-4BB4-B9DF-7998BCCB2397.pngSPOILER_A77C576D-9BFE-416E-96E6-735EED239ADF.pngSPOILER_IMG_4072.pngSPOILER_SPOILER_0F590EA4-FBD5-4D14-9395-4B443AFB253C.pngSPOILER_SPOILER_71AFDB2A-C358-4AE3-84D3-F083FD85D69D.pngSPOILER_SPOILER_15134218-F2F3-4DA9-ADC0-D919EAE65302.pngSPOILER_SPOILER_B16AE6B5-31CD-4575-99DF-C983D137AAE6.pngSPOILER_SPOILER_FF8A70B4-36DB-4E8D-98C0-F32D182A147F.pngSPOILER_SPOILER_IMG_3984.pngSPOILER_SPOILER_IMG_3992.pngSPOILER_SPOILER_IMG_3993.pngSPOILER_SPOILER_IMG_3995.pngSPOILER_SPOILER_IMG_3996.pngSPOILER_SPOILER_IMG_4001.pngSPOILER_SPOILER_IMG_4007.pngSPOILER_SPOILER_SPOILER_Screenshot_2024-03-18_231855.pngSPOILER_SPOILER_SPOILER_Screenshot_2024-03-18_232102.pngTCSGroomingCherry (1).jpgTCSGroomingCherry (1).pngTCSGroomingCherry (2).jpgTCSGroomingCherry (2).pngTCSGroomingCherry (3).jpgTCSGroomingCherry (3).pngTCSGroomingCherry (4).jpgTCSGroomingCherry (5).jpg
GJD9sBxX0AArR_3.jpg
(TehCanadianSpartan/TCS (Jordan Davis) [Mirror] Google Drive\Predator Saga + InktoRosalina, all except last is from the Cherry subfolder, last is from the User #1 (Minor) subfolder)

All of this was so bad that FlutterCherryNM and her friends threatened to levy charges against TCS, which he freaked out about in both FlutterCherryNM’s Steam DMs (begging her to drop the charges) and in bman78’s Discord DMs (where he says he will kill himself if he has to go to prison).
Screenshot_2024-03-21_191802.pngScreenshot_20240325_175405_Discord.jpgScreenshot_20240325_175817_Discord.jpgScreenshot_20240325_180105_Discord.jpg
(TehCanadianSpartan/TCS (Jordan Davis) [Mirror] Google Drive\Predator Saga + InktoRosalina, first is from the Cherry subfolder, rest is from the Taking the cowards way subfolder)

Despite his pleas, TCS still got reported.
Screenshot_20240325_092752_Discord.jpgScreenshot_20240325_092800_Discord.jpgScreenshot_20240325_092804_Discord.jpgScreenshot_20240325_092807_Discord.jpgScreenshot_20240325_092810_Discord.jpg
(TehCanadianSpartan/TCS (Jordan Davis) [Mirror] Google Drive\Predator Saga + InktoRosalina\Playing Victim folder)

As you can probably predict, TCS probably got in this situation due to serious porn addiciton; on a video covering this (PreserveTube), Plormby (one of TCS’s defenders back during the TCS-Peachy drama) left a comment (A) not to defend him, but to reveal that he had managed to take control of his PC and found over 100,000 files of just porn (which was “very bad”), totaling to over 2.5 TB of porn on TCS’s computer!


Over half a year later, TCS made an extremely long Tweet (A) and at the time pinned it as his apology, blaming FlutterCherryNM and comparing her to Peachy (which is quite a way to “apologize” :story:)


It’s not a stretch to say that TCS is an example of how porn addiction can turn one into a pedophile.

bman78
Chronologically, this is quite a bit after the next section, but I feel it is notable enough to mention in the OP. With all the grooming that goes on in SplatSource, there will be groups formed to help get the victims away from their groomers and expose them. bman78 was one of the people part of such a group, but he was hiding a dark secret: at the time he was exposed (May 2025), bman78 had been secretly ERPing with multiple minors for multiple years.
(bman78 Google Drive\Pedophilia\Grim\SPOILER_4FF5ED26-594F-455B-9B2C-724F9286F3D8.jp)SPOILER_image25.pngSPOILER_image26.pngSPOILER_image27.png
(Last three are from the bman78 Google Drive\Pedophilia\Victim #1 folder)

With the minor Alia (starting when she was 12 back in 2020), he ERPed with her heavily in 2020 and continued on and off for almost 4 years! This wasn’t just the run-of-the-mill ERP either, as it was majority rape, with other degenerate topics also included. This is only a small sample of the ERP that was done between the two.
rape erp.pngrape erp 2.png
gangrape.png
forced breast sucking erp.png
love like a little sister, egg laying erp.png
(All of the above from bman78 Google Drive\Pedophilia\Alia\Direct Messages - Alia [699726911605047376].html)

bman78 also received NSFW art made by Alia, featuring her self-insert OC.
Screenshot_20250424_115813_Discord.jpgScreenshot_20250425_065331_Discord.jpgScreenshot_20250425_065444_Discord.jpgScreenshot_20250425_185202_Discord.jpgScreenshot_20250425_185206_Discord.jpgScreenshot_20250425_202000_Discord.jpgScreenshot_20250425_202930_Discord.jpg
(All from the bman78 Google Drive\Pedophilia\Alia\NSFW artworks folder)

More amusingly, bman78 liked to say nigger and nigga.
Gpe0drVbEAAQvlH.jpgGpe0drXbEAQ80wT.jpgGpe0ZCabEAMB7k6.jpgGpe0ZCdawAAaHGd.jpgGpe0ZCfbEAE3NnF.jpgGpe0ZCjbIAAg79N.jpg
(All from the bman78 Google Drive\racist folder)

After he was interrogated over his actions on Discord, bman78 admitted he had a porn addiction and is trying to recover from it, and he planned to cut himself off from wider social media, only sticking to contacts for close friends and family.

Swaggy:
And you do, or… sorta trying to recover from having a porn addiction.

bman78:
Uh… are you asking me if I have a porn addiction?

Swaggy:
No, are like- you either have one, or recovering from it?

bman78:
Ah… I believe I do have a, uh, a porn addiction, but I’m trying to control, but it’s not easy.


bman78:
Yeah, about that, I’ve been planning to make a statement on my Twitter and Bluesky, and uh, just admitting to everything (Swaggy: The things you did?) that- and, uh, telling people what, to like, uh, not defend me, and then uh, I’m gonna like, uh, abandon my Twitter and Bluesky accounts, uh, only thing I’m gonna keep is uh, my YouTube, and uh, my Boomerbook(?) cause I need that to contact my mother.

Swaggy:
Thats- that’s… fair.
bman78:
And… uh, I, I- the only reason why I want to keep my Discord is to chat with my girlfriend and uh, the few close friends I have left. And that’s it.

Like TCS, bman78 is clearly a case of porn addiction leading to pedophilia. At least bman78 can admit that he has a problem, and seeing that he has gone silent ever since then, he has seemingly lived up to his promise. If you want a more indepth look into the Google Drive or into bman78’s roleplay sessions with Alia, check out the following posts:
bman78 Google Drive breakdown
Alia roleplay sessions breakdown

Aaron Peters​
Even if you don’t know about SplatSource, I’m pretty sure you’ve heard about this. In early 2024, Source engine modeler Brewster T. Koopa (who you may also remember as Daddy Godelia all the way back in 2018) reported that many Nintendo-related Garry’s Mod add-ons (which of course included many Splatoon-related add-ons) were being taken down via DMCA claims, initially thought to be false (A).

It was later discovered that the person sending the DMCA takedowns was someone who went by “Aaron Peters” (A), which was a name used before in prior DMCA takedowns of NSFW Nintendo artwork (A).


When the DMCA emails themselves were sent to the modders in question (A), they noticed that the email listed in the contact information was “notice@mm-nintendo.com” and Aaron Peters stated that he sent the email on behalf of Nintendo. This was used as proof that Nintendo was not the one sending the DMCAs, and they actually came from a copyright troll.


Unfortunately for those who thought Aaron Peters was a troll, Garry Newman himself said that the DMCA takedowns were verified by Nintendo (A).


While many still believed that Aaron Peters was just some troll (perhaps in the hope that the takedowns could be reversed), those with that opinion may have jumped to conclusion. The WHOIS information (A, taken from a Reddit post as the domain is currently open as of writing this) of the “notice@mm-nintendo.com” domain shows that Nintendo of America was the registrant for it since 2013, and that the “mm” likely stands for MarkMonitor, a company that specialized in brand protection (which included IP enforcement).


While MarkMonitor isn’t part of Nintendo, Nintendo has outsourced DMCA takedowns to other companies before (in fact, the link Brewster used to show that Aaron Peters did this before mentions that Nintendo was probably using a contractor to send the DMCA takedowns). Plus, as shown on GameJolt’s GitHub page listing all of the DMCA emails they’ve received, MarkMonitor has been sending DMCA takedowns on Nintendo’s behalf since at least 2016 (A).


Regardless of if the DMCA takedowns were legitimate or not, the removed add-ons stayed deleted. While some of the removed uploads were re-uploaded, others tried to archive the add-ons that they had. Brewster T. Koopa, alongside fellow Garry's Mod animator Mister Prawn, tried to set up a Discord server called “The Emportium” to archive the now-removed add-ons. This server eventually crashed and burned because of drama related to Mister Prawn (specifically his association with Zengo and allegedly scamming his clients), which led to Mister Prawn impulsively deleting The Emportium. While I apologize for not having any proof other than @The Unknown Arch@v1$t’s word, I can confirm that this is a reliable enough testimony.
Regarding the Brewster situation, that was more so connected with Mister Prawn, Zengo's only true pawn who willingly helps Zengo even knowing the true of all the things he did. He was the one who deleted the Emportium after he kept getting called out keeping Zengo around and for also scamming his clients (At least according to what I've been told, Idk the story regarding Prawn scamming people) so he had a knee-jerk reaction and deleted it. Needless to say, everyone who was part of that community was pissed at Prawn.
(I then ask if this is related to the Aaron Peters takedowns)
B. Yes, you're exactly correct. The Emportium was a server meant for archiving the Nintendo GMOD addons

No matter the efforts of the re-uploaders and archivists, the hurdles new and returning SplatSource animators had to go through to get these add-ons was too much for some and caused them to leave the community. For example, “wai_wai_channel,” a Japanese Splatoon Garry’s Mod channel, temporarily stopped uploading Splatoon Garry’s Mod animations because of the add-ons getting removed (which he mentions at 0:47 in the video below).
Long time no see. It's been a long time since I stopped uploading videos. I'll talk about what we've done and what we're going to do. I've been drawing cartoons for about a year. I uploaded a video about it on Cat meme. It's about trying to become a cartoonist. It was so unpopular that I eventually deleted it. But I draw cartoons now. I'll probably continue to draw them. The reason I didn't make the video is.. It’s because of an incident last year. The situation made it impossible to make a video. Models are not available. But they're available now, so I can make videos. Then, I'll upload Splatoon videos. I posted a link to the cartoon I've drawn. They have nothing to do with Splatoon and are poorly drawn and unsightly. I'd be very happy if you see them. From now on, I'm going to aim to upload one video a month. Thank you for your continuous support. See you !

The Lewd House drama was quite devastating to the SplatSource community, but it could be argued that the Aaron Peters DMCA takedowns were almost a nail in the coffin for SplatSource. Splatsource is obviously still around, but not to the extent it was only a few years ago.
 

Attachments

Last edited:
Associated Figures​
Tailasy
Thanks to @Sperg Spectating for bringing this to my attention!
Tailasy's story is both horrifying and funny, and while I'm not sure I can do it justice here, I'm going to try.
According to the Hitler Parody Wiki, Tailasy used to be an Unterganger, or someone who created parodies of Hitler’s ranting from the movie Downfall.
(Hitler Parody Wiki article on Tailasy)
They make parodies from this scene.

Local archive of this YouTube video (PreserveTube)

To put it simply, he was a Taiwanese troublemaker from the very beginning. Early in his time in the Hitler Downfall Parody community, he started trouble by calling Jeejeesh “a fat Polish kurwa” on her birthday.
(Hitler Parody Wiki article on Tailasy)

He would eventually call her “a big fat bitch,” which would justify his unanimous ban from Unterganger Chat Central, some Discord chat room for a large Hitler Parody group. The Discord staff banned him after luring him in by holding a fake UnterCast (some sort of podcast where Untergangers would chat freely) and proceeded to troll him afterwards, according to the Hitler Parody Wiki.
(Hitler Parody Wiki article on Tailasy)

He was (and probably still is now) a Brony and a “clopper” (someone who jerks off to My Little Pony porn).
123
(From the Hitler Parody Wiki article on Tailasy)

He would cause more trouble in this community, getting more hated in the process, and would soon be permanently banned from the Hitler Parody community. But as you can guess from Zoey’s images, Tailasy would soon become less funny and more horrifying. On September 5, 2018, TheMilitantHorse would release a PSA, warning people of the pedophilic actions of Mastered Ultra Twils, manother identity of Tailasy. It also came with a Google Drive link, but it seems to have been long since deleted.
PreserveTube

What was found out about him:
Tailasy asked Annie, a 14-year-old, to send NSFW videos. When she questioned that, Tailasy said he got hacked.
Mastered Ultra Twils PSA, 9:39Mastered Ultra Twils PSA, 9:46

Tailasy would try to do some skeevy RP with Kourtney (a minor) and tell her that he likes 12-15 year olds.
Mastered Ultra Twils PSA, 10:06Mastered Ultra Twils PSA, 10:08

TheMilitantHorse made an alt Discord and pretended to be a 14-year-old girl to confirm if Tailasy was a pedophile. Eventually the two would get into DMs, where “Nikki” asked Tailasy if he wanted to see her breasts. TheMilitantHorse found some pic online and sent it, and Tailasy, believing it was a 14-year-old’s pictures, said it was too small and should be bigger, along with an “:3” emoticon. At this point, TheMilitantHorse drops the facade, pissing off Tailasy.

TheMilitantHorse:
And… basically, to kind of see how he behaves, I ended up making an alternate account, known as “Nikki,” which is based off of my dog. You know, I’ve- I talk about her a lot, um… I've named the account after my dog, Nikki, and… Nikki was this 14-year-old California girl, who, uh, joined his server one day, and she- you know, she was like, just this, you know, kind of happy-go-lucky girl.

And- So she ended up talking with him. And, one day after, like, we began to press Twils, he basically came to her and was like, “Oh,” well, you know, “I,” you know, “I’m sad,” and, you know, so the two like, they cuddled for a little bit, you know, per- asterisks, eh. Um… and I had- made Nikki ask if, uh, Twils wanted to see her- her breasts, and um, Twils never s- stopped, he never said no, which I mean, I know it would technically be Nikki’s fault in this case for instigating it, but Twils never said, “Well, people are accusing me of pedophilia,” so, you know.

And… basically, I went and found, just like a random picture online, just a random like, you know, random photo online of an adult, and sent it to him, and… the thing he said afterwards, you know, with his- with him believing that it was a 14-year-old he was talking to, what he said next… oh, that, that kinda churned my stomach a little bit. Yeah, you- you c- you can probably see why. Um, and so, like… just, we kinda continued this for a little while, until finally I ended up springing the trap on him. I- I told him who it was, that I was… that I was… mys- that Nikki was me, it was an alternate account. And he got mad about this, but to be fair… uh, I already had enough proof, about what he was doing.

The reveal of his pedophilic behavior along with his past behavior made a lot of people understandably hate him. In fact, some members of the SplatSource community hated him so much that they would put him as an enemy in their OC's pages, as shown by this page on General Salty's OC.
(Squidtopus Archives article on General Salty)

However, this also resulted in some really dumb gay-ops, such as this one person who would pretend to be Tailasy and send some comically over-the-top pedophilic messages in some Discord server.
PreserveTube

Anyways, Tailasy would continue on, usually changing his identity after eating bans. After being booted from the Hitler Parody community, one of the communites he would show up in (and related to this thread) the Splatoon community. He made some Splatoon art on his Instagram and e-dated Glitchy_Stone, someone in the Splatoon community. From her interview in Content Crasher: Tailasy, it looks like he wasn’t the best boyfriend.
(Tailasy's Instagram account)

Content Crasher: Tailasy, 7:10Content Crasher: Tailasy, 7:24Content Crasher: Tailasy, 7:44

On his DeviantArt page, he made some art in 2019 showing that he had some interest in SMG4. potentially before Meggy Spletzer (initially an Inkling girl character in then-and-now mostly GMOD-based show, his strongest link to SplatSource) became a human character.
(Robotic Desti)(Meggy Splatzer)

Based on Tailasy exposed Part 2, Tailasy liked Meggy a lot more than usual.
Tailasy exposed Part 2, 0:17Tailasy exposed Part 2, 0:22

Interestingly, the "Muffy" Tailasy is speaking to might be Rosy the Octoling (the person who helped the Seven Deadly Boomers expose the Lewd House), based on Rosy the Octoling's current Splanimations Archive article.
(Splanimations Archive article on Rosy the Octoling / The Kid with Sunglasses)

The most recent identity of his that I know of is FallithSolaris, according to this Google Doc (A), but it seems even this identity was abandoned; as of writing this, he seemingly changed to RaidenSBlack on Twitter, but got his account suspended.
(Boost's Tweet about Tailasy)

This is only scratching the surface of Tailasy, but since his link to SplatSource is pretty weak, I'll stop here.

Tiffany Skylar Johnston / Zoey / Splatinist / many other names
Thanks to @Schizoid Wife for bringing this to my attention!
One of our very own lolcows, @Tiffany Skylar Johnson (commonly referred to as Zoey here) has had some interactions with this community. Alongside being a general Splatoon fan, she made herself part of SplatSource starting in 2018, using Source Filmmaker and even calling another SplatSource member InkCircuit her “brother” (not really her IRL brother).

Angry Lurker's Kiwi Farms post showing Zoey’s desktop
Relinquish's Kiwi Farms post going over her “brother” InkCircuit

Zoey’s first run-in with SplatSource drama on her main account was talking about DeanMarr/DeanTheSquid (who used to be her friend, A) on her @bannanahshu Twitter account, exposing for (in summary) dating a 15-year-old while 18, giving her access to NSFW (which alarmingly was consistent with his past behavior), and suicide-baiting (partial archive).

6.1.png6.2.png
Callout Tweet:
6.3.1 callout 1.png6.3.2 callout 2.png6.3.3 callout 3.png6.3.4 callout 4.png

Suicide bait Tweet:
6.4.1 suicide bait 1.png6.4.2 suicide bait 2.png6.4.3 suicide bait 3.png6.4.4 suicide bait 4.png

(Splatsource_Dirty_Secret.zip, 21:36)

In 2020, DeanTheSquid was exposed for dating a minor Luna/Lumi (who was 15) when he was 18 (A).


Somewhat uncomfortable age gap, but it should be fine as long as nothing got NSFW, right? Well, egregiously, DeanTheSquid let Luna and multiple other minors view NSFW content in his DIscord server (A).

"the NSFW channel was more minors teaching eachother about that stuff for the future" :cryblood:

He also apparently asked for a 14-year-old’s nudes? WTF?
(Splatsource_Dirty_Secret.zip, 22:31)

Worst yet, apparently this wasn’t the first time DeanTheSquid was caught grooming minors.
12
1/A
2/A

Dean had apparently been in contact with 4 other minors, “Rydog” (14), an anonymous minor (13), another Luna (12), “Belle” (14), and two who wished to remain fully anonymous. He was the age of majority (16 in Scotland) and above when he dated some of them (16 when dating the 12-year-old Luna, 17 with everyone else) and made uncomfortable advances on the other minors (presumably the fully anonymous ones).

Joxic:
Dean Marr has recently [been] called out when people have discovered he was dating 6 minors during his career.
(Text on screen makes correction and states that Dean dated 4 and made uncomfortable advances to 2)


Joxic:
“But Joxic, what about the other victims? I mean, they must be old enough, right?” Fuck, I wish they were, so I didn’t need to talk about this fucking loser. Dean has also dated 5 other minors (text on screen corrects him and says it was 4), with their age of the victims where they were also in contact with Dean. “Rydog,” who was 14 at the time, [censored name] 13, another Luna - who I’ll refer to as “Luna 2” - who is 12, “Belle” - I couldn’t find a tag - who was 14, and a few others who would prefer to stay anonymous. Dean was 16 with Luna 2 and 17 with the others.

Some more screenshots of Dean talking inappropriately with minors and guilt-tripping.
(Splatsource_Dirty_Secret.zip, 22:31)(Splatsource_Dirty_Secret.zip, 22:32)(Splatsource_Dirty_Secret.zip, 22:33)

Dean had also made a separate NSFW group DM for him and the minors.
(Splatsource_Dirty_Secret.zip, 23:28)

The 15-year-old Luna would soon break up with him over Discord as a result of this scandal.
(Splatsource_Dirty_Secret.zip, 22:12)

He would eventually make an apology, leave Twitter, and go on “hiatus.”
(Splatsource_Dirty_Secret.zip, 22:53)(Splatsource_Dirty_Secret.zip, 22:58)

He would try to return in December 2020, but he was told to leave (A). At the end of 2020, he tweeted out that he returned to Discord (A). Other than that, he seems to have disappeared from the public eye; nothing public from him is dated 2021 or after.

Exposing DeanMarr must have inspired her, as a few weeks later she started a drama account called @splat_watchlist to report on “splatoon idiots.” During this time, she went by “Charlie”; if you see “-Charlie” or anything similar, that’s from Zoey.
(Introducing the splat_watchlist account)

She would eventually share ownership of the account with @succidick, also known as “Shu.” There was also a third person, Erin, but this person would eventually leave the group a few days after changing to Aaron.
(succidick (Shu) joins)(erinthewaffle joins)(erinthewaffle becomes aaronthewaffle)(Later re-introduction without aaronthewaffle)

Shortly after Shu was included, Shu would make a post on the splat_watchlist account uploading a (now unavailable) audio file of supposedly TheMystcialMatty admitting to being transphobic, being homophobic, watching CP, and (implied from a follow up Tweet) owning CP. Apparently the source of this audio file is @CanadaFlag_BFDI.
(Shu calling out TheMythicalMatty)Shu credits @CanadaFlagBFDI

This account happens to be an old username of TehCanadianSpartan, as searching the name on Twitter shows. It matches with his past, as before SplatSource, TCS used to be an object show fan; in fact, he actually shows up in this post about the Object Show community:
(Proof @CanadaFlagBFDI is TCS, 1)(Proof @CanadaFlagBFDI is TCS, 2)(Proof @CanadaFlagBFDI is TCS, 3)chimpburgers' post

One of the first Splatoon idiots Zoey reported on (when it was just her on the account) was Toilet/Tailasy.
(Zoey calls out Tailasy)
1234

This callout Tweet was relatively unique, as usually Zoey would ask for others to send her evidence to report on instead of investigating herself.
(Evidence wanted for RubyIsWanted)(Evidence wanted for IdaKyrie)

Zoey’s first interaction with the SplatSource community on the splat_watchlist account would be commenting on Source Sentinel’s callout post of SharkySFM, an underage SplatSource artist who made NSFW content and suicide-baited.
(Zoey’s response to initial SharkySFM callout)
(Source Sentinel’s SharkySFM callout post, image 1)(Source Sentinel’s SharkySFM callout post, image 2)

Zoey would say that Sharky was using her mental illness as an excuse to make NSFW, and also leaked her Discord DMs with Sharky’s boyfriend, Idogg during the Dean the Squid drama, where Idogg defended Dean.
(Zoey leaks DMs)
1

Sharky would later tweet about having a phase and a breakdown, Zoey advises her to take a break, not use her dissociative identity disorder as an excuse, and says not to be horny around others.
(Zoey gives advice to Sharky)

Sharky didn’t take too kindly to Zoey’s advice, and doesn’t want to take it. Despite her ostensibly kind tone in the responses, this might have been the event that started Zoey’s “crusade” against Sharky based on what happens after this.
(Sharky fights back, Zoey just wants to help)

Once InkyxKitty came back from her break (and came out as a non-binary lesbian, archived in her section), Zoey would ask to speak to her in DMs.
(Zoey asks InkyxKitty something)

Three hours after speaking with Kitty in DMs, Zoey would come out with a theory that Kitty and Sharky are the same person, based on the fact that they both have similar behavior, both use the same OS for Twitter, and both have very similar SFM art styles.
(Zoey thinks InkyxKitty = SharkySFM)
12

According to Zoey, Kitty came back minutes after Zoey said she may also be Sharky, and would ask her audience if they have any evidence to add.
(After saying theory, InkyxKitty came back fast)

Unfortunately for Zoey’s theory, not only are the operating systems that they both used very common, but multiple people would tell her that Sharky taught Kitty SFM, which helps explain why their styles are similar. Zoey would brush the second point off as a possible excuse by Kitty/Sharky. Apparently this wasn’t even an original theory :story:
(iFlashboy's Tweet)(FourMutantFish's Twitter thread)

Zoey seems to think that Sharky is the real one and Kitty is the alt, based off of her interactions with GenSh1be.
12
(Sharky is the real, Kitty is the alt)

More points against Zoey’s theory is that people who have interacted with Sharky and Kitty tell her that they’ve seen their faces before, and said faces are different. Ry_Dawg (one of the minors that Dean dated) tells Zoey that she saw both of their faces before, Zoey asks Ry_Dawg to reverse image search them if she still has them and asks a few questions about Kitty’s photo.
12
(Asking Ry_Dawg about Sharky and Kitty's faces)

Idogg (Sharky’s current boyfriend and ex-boyfriend of Kitty) tells Zoey that Kitty is “WAY different than Sharky” and has seen both of their faces. Zoey would use what Ry_Dawg told her about Kitty’s face reveal (specifically the high quality part), which according to her doesn’t sound right as Kitty supposedly has a poor device. Zoey also doesn’t believe Idogg unless he can confirm that they sound different in calls.
12
(Zoey doesn't believe Idogg)

Unfazed by these rebuttals, Zoey would continue to allege that Kitty is Sharky; for example, in a response to Kitty telling people not to be LGBTQ+ for attention (funny, considering Kitty's past).
(Zoey replying to InkyxKitty's Tweet)

Zoey would also claim that a piece of art that Sharky posted wasn’t made by Sharky, but doesn’t seem to provide a link to the true owner. It was deleted anyways by the time it was archived, so it’s likely that Zoey was correct.
(SharkySFM reposted art without credit)

Later, one of Sharky’s friends, VioletSFM, would make a Tweet with a bunch of texts from Sharky, implying that Sharky had killed herself. Zoey thought that this wass another fake suicide and Sharky wass actually acting as Violet.
(Violet’s Tweet about SharkySFM)(Zoey’s response to Violet)

Idogg understandably gets pissed off as Zoey, and Zoey responds that she is just skeptical that Sharky is actually dead.
(Just presenting an argument)

It turns out Zoey was somewhat correct; DjSwaggy (Seven Deadly Boomers member) posted screenshots of Sharky’s Twitter thread that she made, clearly showing that she is still alive. Sharky had texted Violet to vent about taking a break from social media, but Violet had backstabbed her by overreacting, leaking the texts, and implying she had killed herself. Zoey gloated a little afterwards.
(DjSwaggy Tweet showing that SharkySFM is fine)(Zoey's response to DjSwaggy's Tweet)
Violet assumed Sharky was going to kill herself because Sharky had talked about wanting to kill her past self (the one that made NSFW while underage, told Kitty to kill herself, suicide-baited, and defended Dean.
Regarding the “Sharky is Kitty” drama, Sharky had video-chatted with Kitty before, Sharky told Kitty to kill herself, Sharky says she helped out Kitty when Kitty was starting out, and so far all the evidence for “Sharky is Kitty” is coincidental.
Sharky’s texts were only meant to be read by Violet, explaining to her why she would be gone for a while. If Sharky’s sister didn’t tell her what was going on, people would think she is dead.

It seems Zoey’s focus on Sharky ended here. Zoey would then focus on another person, Amphy, after Amphy suggested someone censor out something on a frantic callout post.
(Zoey getting mad at Amphy)

Amphy would soon leave the SplatSource community, but would get mentioned by Zoey again when his SplatSource drama got brought up during some Pokémon trading drama.
(Pablito Tweet about Amphy leaving)(Zoey replying to Amphy about Splatoon drama)

Interestingly, it seems Tailasy, under one of his known aliases Zephy (or a potential gay-opper), would threaten to report Zoey’s splat_watchlist account; in response, Zoey says she has his IP.
(Zoey threatening to reveal Tailasy's IP address)

The last two people Zoey would report on are SquiddyOwO and GenSh1be, someone who questioned Zoey’s “Sharky is Kitty” theory.
SquiddyOwO calloutGenSh1be callout
Linked thread on GenSh1be (Internet Archive)

Amusingly, Zoey had used the account to respond to some Battle for BFDI fan talking trash about her on Twitter. After her callout of GenSh1be, the account would become pretty dead after that, as Zoey claimed she was looking for stuff worthy of reporting on.
(Using account to talk to a BFB fan)(Account became dead)

Of course, Zoey has done much more later outside of SplatSource; if you’re interested in her antics, check out her thread here:
https://kiwifarms.st/threads/tiffan...latinist-xkiwifarmjoshx-and-many-more.197481/

Captain Baz
(CptBAZ DeviantArt profile)

Captain BAZ started out as a regular Splatoon player and fan (or as regular as a fan could be being over a decade older than the target audience). Most amusingly, he was also a Marina self-shipper who “held” a wedding with her on Instagram (A), inviting all of his Splatoon friends on Instagram.


He would get called out for stealing art (A), specifically reposting art on his Instagram account and putting in the caption “credits to the artist."
3 callout.png

Because the account that was calling him out was run by two Italian lesbians, he would quickly become homophobic.
123
1/A
2/A
3/A

While nothing would really come from that besides an Internet slap-fight between the two, sometime between 2018 and January 2019, Captain BAZ groomed someone named “marina_bae,” but was caught and then apologized for it (A).


For some reason, Captain BAZ would keep grooming minors, as throughout 2019, multiple minors would come forth about being groomed by him. The youngest minor that was groomed by BAZ was 9, which he seemed to confirm in the next image on the Instagram post (A (Partial)); however, the picture is cropped where it doesn’t show Captain BAZ saying it, so I am somewhat doubtful if he actually admitted it.


It seems like the person to expose BAZ grooming a 9-year-old was Neil_Purpleboy, someone who Captain BAZ made an SFM poster for in the past (A), used to support Captain BAZ but changed once the accusations started coming out (A), and (interestingly) was in the Lewd House as an in-house NSFW artist.
  (Lewd House Heist SFW Dropbox\TehCanadianSpartan\tcscommissioningporn5.jpg)

In 2019, one of the cpt.bozo accounts would call for a raid on Captain BAZ’s social media accounts (A), unmasking him and his social media accounts.


Even during this controversy and raid, Captain BAZ would still manage to have a public presence. It seems like he joined the SplatSource community in 2021 (even when more minors kept coming forward), as his earliest surviving SplatSource picture on his abandoned DeviantArt account (A) was uploaded on June 25, 2021.


But the pressure was too much, and Captain BAZ did eventually leave the Splatoon community altogether. In fact, he became a hypersexual transgender VRChat streamer called “Miss Breezy Kawaii,” but now he currently goes by “Miss Breezy VTuber.”


As you may expect, the grooming and the drama did not stop there. If you want more in-depth information about the drama around “Miss Breezy Kawaii” or Captain BAZ’s past, check out this post or his thread.

Zengo Oshiba
While Zengo Oshiba is not part of the SplatSource community, or even the wider Splatoon community, he has had quite the interactions with some of its notorious members. Zengo was familiar with ghostoftime1 and LizzieRatcicle because they were friends with his then-friend JojoverseHeroes, but his closest tie to Splatsource is his interactions with one of SplatSource’s most notorious members, Ellie Godelia. Zengo knew about her behavior in the Lewd House, and even called her a pedophile (and saying they are “beyond saving”) when asking why someone was still following her.
   (Florae Fempyro leave my friends alone! description)
(First three are from To Catch A Squirrel Google Doc)

Despite Zengo’s public opinion of Ellie, a person named Tacogirl (very likely actually Zengo on an alt account) pushed Ellie to talk with Zengo. It didn’t really work out at first.

(All from To Catch A Squirrel Google Doc)

Despite a poor first impression, Zengo and Ellie seemingly made up, where Zengo got sexually-forward towards Ellie and asked for some quite suspicious stuff.

(From To Catch A Squirrel Google Doc)

Later, Ellie finds out Zengo threw a tantrum in DMs with her friend Ray Brighten (which is related to some drama specific to him), causing her to give a light ultimatum. Zengo then begged and pleaded for sympathy, which Ellie saw right through.
(Unfinished Business, 2:43:40)
(Unfinished Business, 2:47:30)(Unfinished Business, 2:48:12)(Unfinished Business, 2:48:15)
(Unfinished Business, 2:49:00)(Unfinished Business, 2:50:02)(Unfinished Business, 2:51:12)(Unfinished Business, 2:52:07)

This caused a falling out between the two, leading to Zengo blocking Ellie. When Zengo was later asked about Ellie, Zengo claimed he was only teaching Ellie SFM and letting her vent to him, and that they only separated because of a heated argument.
(To Catch A Squirrel Google Doc)

A few days later, Ellie vented to someone named DizzyKat (this is also very likely one of Zengo alts) about Zengo’s behavior, and DizzyKat pushed Ellie to get back with Zengo.
(To Catch A Squirrel Google Doc)(To Catch A Squirrel Google Doc)(Unfinished Business, 3:43:16)

Who was DizzyKat? To Ellie, DizzyKat was her sugar mommy who offered to buy her gifts for her, leading to Ellie giving her address to her when “DizzyKat” offered to buy her stuff from Amazon.
(Unfinished Business, 3:00:07)(Unfinished Business, 3:01:52)

Interestingly, DizzyKat claims ghostoftime1 groomed her on an old account, which I do not believe at all for multiple reasons (one being that Zengo is older than ghostofitme1 by almost a decade). A week after, Dizzykat would reveal that she is Zengo’s cousin.
(Unfinished Business, 3:05:28)(Unfinished Business, 3:25:58)

While Ellie was getting back with Zengo, DizzyKat was very forward with Ellie and asked for nudes. DizzyKat also confessed her love for Ellie, and Ellie told Zengo, only for Zengo to reveal that he was also in love with Ellie. Despite the two being cousins, they were both okay with dating Ellie at the same time.
(Unfinished Business, 3:17:36)(Unfinished Business, 3:52:29)(Unfinished Business, 3:53:23)(Unfinished Business, 3:33:12)

Zengo kept feeling the heat from his association with Ellie, so he made an alt account to secretly contact Ellie with. However, after Ellie goes on 225 At Nite (a stream run by Zengo’s “enemies” Delta225 and Pineapple) to talk about the Lewd House, Zengo panics, and thinking that she leaked everything decides to cut her off.
(Unfinished Business, 3:57:12)(Unfinished Business, 4:03:43)

This wouldn’t be the end of Zengo and Ellie’s interactions though; remember how Ellie gave her address to DizzyKat? Two years later, a Twitter account called NeedleMan2123 (which already shared a lot of similarities to Zengo, as explained in his OP) doxed Ellie Godelia.
(links to some of the screenshotted Tweets in his thread)

Clearly Zengo was not over how Ellie leaked more incriminating information about him. To see local archives of the sources used here or read more about him, check out his thread.

Splatoon/SplatSource Drama Groups
With all of this drama and the characters involved in this community (both fictional and real), it would be inevitable that people would want to either start drama, or report on it. When it comes to the early stuff, you’ll have to bear with me because a lot of this stuff has been lost to time and is based on what I’m seeing years after the fact.

ANTIINKLING
One of the first trolling/drama groups in the Splatoon community (as SplatSource doesn’t seem to have been considered separate from the community at the time) was AntiInkling, with its DeviantArt group being created in early April 2017.
12
(About AntiInkling)

As you can see from its icon, it contained people who were edgier than the typical Splatoon fan. It seems the original purpose of this group was to raid a (likely Discord) server titled “The Inkling’s Stronghold,” which probably made suggestive/NSFW Splatoon art.
(We need Members people!)(Important!)

I’m not sure if this raid ended up being successful or not, but this was apparently enough to get targeted by the “pedos.”
(IMPORTANT)

The last post from this DeviantArt group that survives is this message, calling out the community leaders at the time.
(Inklings!)

This might have been the lead up for the group’s leader, Ice7Rule7King, to start exposing Heavy the Squid. He made a Tweet exposing HeavyTheSquid for trying to meet up with the then-16-year-old Ellie Godelia.
(To Catch a Squidette, 5:11)

As shown in the Heavy the Squid section, Ice7Rule7King would also leak messages from a Discord group chat known as “The Splatfamily,” which prompted HeavyTheSquid to essentially witch hunt Ice7Ruler7King.
(To Catch a Squid, 3:42)(To Catch a Squid, 3:45)

While it contains only a paltry 10 members as of writing this section, in the past it seemed like it had more members and people joining. This included someone known as Jacktropolis, whose joining caused a bit of drama. I addressed it in this post, but the TL;DR: is Jacktropolis made some art “attacking” a SplatSource fart fetishist, then after joining AntiInkling, got his Discord servers hacked by a hacker paid off by said fart fetishist until he “owned up to his toxicity.”

Being such an old group (relatively speaking), during the TehCanadianSpartan and Peachy drama they were assumed to be the ones behind the whole thing, as stated in their section.
(TheCanadianSpartan Dropbox\TCS’s fans witchhunting\tcsdeviantartfanwitchhuntattempt.png)

(Talking about who people thought was behind the Peachy plan)
Ishi:
Wasn't it Rudy that fuckin' said- no it was Rudy that said, fucking, AntiInkling did that shit, when it was clearly us- it was clearly, it has us written all over it!

The group seems to have existed up until sometime after Jacktropolis was exposed:

LtBlazeWwW:
Yeah. Um, so yeah, uh, yeah I did forgive Jack. Um, and uh, because like, uh, him and I agreed that relationship drama is personal, and it really shouldn't have- he really shouldn't have gotten the amount of hate that he did. Um, and then eventually even Ryan forgave him.

BruhNolaBar:
Yeah, I forgave him as well, pretty much the whole (LtBlazeWwW: Yeah.) Anti-Inkling like, group like forgave him for-

LtBlazeWwW:
Yeah, pretty much the entire Anti-Inkling- I wasn't in Anti-Inkling, but...

BruhNolaBar:
Yeah, you weren't. Yeah, I know you weren't because I was in it.

LtBlazeWwW:
Yeah. And- and um. So yeah, basically the entire Anti-Inkling group forg- forgave him, and then I forgave him. And uh, cause like we agreed, "Okay, yeah, this was personal." And he shouldn't have suffered this much from relationship drama, And like, for me, chose to forgive him.

But after this, it seems like the group faded into obscurity. With Jacktropolis getting into drama, it’s likely its members left SplatSource entirely or joined other drama groups.

TEAM DOWNFALL
Founded and headed by LolAttack, Team Downfall was started on January 6, 2018 to expose “the filth” of the Splatoon community.
(Splanimations Archive article on Team Downfall)

They seem to have initially risen to prominence from their Downfall videos on Heavy the Squid (taken down) and Ellie Godelia. From this, they would also make drama on other people in the SplatSource community, as shown by this archived Downfall video on JJGamer:
PreserveTube

The group had started a podcast on August 16, 2018, creatively titled the “Team Downfall Podcast,” where they would talk almost every day. It doesn’t seem to have been archived, and the only notable thing about it was the day it started, JJGamer (who was getting called out before the JJGamer’s Downfall video) showed up under an alternate name and tried to play dumb when called out on it.

LolAttack:
On the 16th of August, 2018, we live streamed a brand new episode of the Team Downfall Podcast. It’s a… near-daily livestream series we run. And it was going normally until a user named Razor showed up. I noticed the name from us- a conversation a few Team Downfall members had and shouted out that it was actually JJGamer. Play the clip.

(Livestream)
Discord Kid:
Until you finally get it right.

LolAttack:
Wait guys, guys, guys. I just realized something.

Discord Kid:
What’s up?

LolAttack: JJGamer’s in the chat.

Discord Kid:
Breh!

Discord Guy:
JJGamer?!

Discord Girl:
That’s what- that’s what I texted you for! (LolAttack: Yeah!) That’s what I texted you-

LolAttack:
Yeah, JJGamer’s under the name Razor.

(Video)
LolAttack:
When he got called out, JJ started saying stuff like, “Eh? Who’s JJ? I’m new to DeviantArt.” Even though when you take a look at his Google+... yeah, you can see what I’m talking about with this.

According to its article, the original Team Downfall “collapsed” in March 2019 after LolAttack suddenly left without a word. The TDF Archived channel has one original video, a slideshow of comments discussing Team Downfall on their reuploaded Team Downfall videos.
PreserveTube

From this, “Flowex,” supposedly sent some messages that confirm that LolAttack left and became the server owner after LolAttack left Team Downfall.
(Welcome to the TDF archive channel!, 0:26)(Welcome to the TDF archive channel!, 0:28)

In addition, the Team Downfall Discord server supposedly was deleted after it fell into chaos once LolAttack left.
(Welcome to the TDF archive channel!, 0:24)

Despite this collapse, it seemed to have been revived temporarily. As stated in her section, Ellie Godelia joined Team Downfall around May 2019 to prove she could redeem herself.
(Where Are They Now? 1.0, 3:33)

Flying Scott:
When Ellie joined, it was to show that people that TDF covered could redeem themselves.

In what is essentially a follow up video to the “Where Are They Now? 1.0” video, Flying Scott interviews ex-Team Downfall member Paruko in his video “What Happened To Team Downfall: An Interview With An Ex-Member.”
PreserveTube
  • Pre-interview: Team Downfall disappeared after Ellie Godelia started working with them
  • Who are you?
    • Paruko/DJ, was overseer of Team Downfall v2
  • Will you name names or use nicknames
    • Will name public names, behind-the-scenes people will be nicknamed
  • Why did Ellie join?
    • LolAttack made her a part of it
    • Other members thought it was odd because of the Downfall video on her
    • Entirely LolAttack's idea, he insisted when everyone else tried to fight it
  • How did Ellie fare in Team Downfall?
    • Paruko was script-writer
    • Ellie helped to collect evidence
    • LolAttack had Ellie join to show that people covered could be forgiven
  • Isn't it an abuse of power for Ellie to collect evidence? What did LolAttack think of that?
    • Generally already a strong power imbalance in the unstructured Splatoon community
    • LolAttack believed he did nothing wrong
    • LolAttack would claim he ended Team Downfall because it was giving him too much stress
      • (What Happened To Team Downfall, 4:43)
      • But actually it was likely after being confronted by script writers about abusing his powers
  • What were the signs that Team Downfall would fall apart?
    • Already seemed like it was falling apart by the time Paruko joined
    • Paruko felt weird when LolAttack said he wanted to remake Team Downfall
    • Felt like one of the main reasons she was recruited was because she had a lot of dirt on Team Downfall
      • Posts, other things behind the public's back such as harassment and SFM art of Ellie Godelia that was "very not appropriate for YouTube"
      • Harassment tweets: (What Happened To Team Downfall, 5:56)
  • How did Ellie react to her Downfall video?
    • Her Twitter was inactive for a couple of months
    • The SplatFamily Discord server got deleted
    • Ellie tried to reflect on herself
    • Old Team Downfall members started to harass Ellie
      • Repeat of Twitter screenshot in previous question
  • What was the tipping point for Team Downfall to target Ellie?
    • Ellie likely got targeted because of the amount of attention she got after the HeavyTheSquid drama
    • Team Downfall found Ellie did some shady stuff, called her out for it
    • If you do stupid stuff on the Internet, it will not get forgotten
    • Hopes that after this video's release, people will realize how messed up LolAttack is
      • Not the only person to think this, some splinter groups formed from the Team Downfall collapse (Order-7, Splat Syndicate) are also anti-LolAttack due to his shady actions and abuse of power
  • Do the people still left in Team Downfall want to side with Ellie or distance themselves from the whole thing?
    • LolAttack made huge mess of everything
    • LolAttack should own up to causing drama and inciting harassment towards Downfall subjects
    • Some servers (like Ellie's) you can't talk about Team Downfall because its members are in it, still defend LolAttack, and censor criticism
    • LolAttack is still making videos, allegedly working with shady people
  • So what you're saying is that this whole thing started from pettiness, and adding Ellie made it worse, causing the team to disband?
    • LolAttack basically used everyone in Team Downfall
      • Never gave updates, never did anything for the new team
    • LolAttack was lazy, Paruko and fellow writer "W" worked hard to make interesting videos, yet people were leaving because it had been 5 months since last Downfall
    • Unfortunately, lots of evidence from ex-members was already deleted by the time of the interview
    • Would like to have a word with LolAttack, but he likely won't change, so what's the point?
    • People had already leaked that Ellie joined Team Downfall v2, so trust was already broken by then
      • One of them was the Team Downfall member in Ellie's server, "G," who accidentally leaked it during a Team Downfall livestream
Tl;DR: Team Downfall disappeared after Ellie joined; after March 2019 LolAttack had remade Team Downfall again and invited Ellie to join, against the wishes of its current members; LolAttack and Team Downfall members incited harassment against Downfall subjects in the past LolAttack was a bad leader and caused ex-members in splinter groups to be anti-LolAttack.

For some reason, the video has [OUTDATED] in the title. Based on this comment, I assume it was because the video was somewhat sympathetic to Ellie Godelia, who would in a few months time get tied up with the Lewd House and its scandal. It seems like Flying Scott was trying to cover himself to avoid angry comments about him “supporting” Ellie by the time of the Lewd House.
(What Happened To Team Downfall, comment section)

Unlike AntiInkling, Team Downfall seems to have imploded due to poor management and internal drama instead of fizzling out over time. Unfortunately, most of Team Downfall’s videos, besides the ones covering Ellie Godelia and JJGamer, seem to have been lost to time when Team Downfall disappeared.

SEVEN DEADLY BOOMERS ASSOCIATION
The Seven Deadly Boomers Association (usually shortened to the SDB Association or SDB) seems to have been the most well-known out of the SplatSource drama groups. Headed by Ishi, it was likely made up of ex-AntiInkling members and was formalized during or after the TCS-Peachy drama.
During the TCS-Peachy drama, Ishi is stated to be the “leader”:

(Talking about who to add to DM group to get Zeldaboy’s opinion on TCS)
Peachy:
Uh, what about Ishi? Does Ishi need to be in?

Blazin:
Yeah, of course, of course!

Discord Guy: (underneath chatter of everyone else) Yes, he's the leader of this-

The Seven Deadly Boomers group is called “Ishi’s group” in a leaked Discord group chat between TCS and his friends:
(TehCanadianSpartan Two; Electric Bungaloo SFW Dropbox\Mass reporting saga\Full Chatlogs\Direct Messages - Broadside, Noctis Axton Aurora, TrueLegendary, JackInkling, JaXson [642440737874771983].html)

Jacktropolis, who joined AntiInkling in the past, had a server whose admins were involved with Ishi and the TCS-Peachy drama:
(Skylar Karategirl: Pretension Incarnated, 0:16)

The Discord server with Ishi, Peachy, and the others contained a lot of edgy humor, which would match with members of a group with a Confederate Flag-inspired icon; some examples:
Screenshot_20190909-082546.pngScreenshot_20190909-082222.jpg
(TCS is lying to you Dropbox)

As expected, the SDB Association had a Twitter account where drama would be revealed, such as when they revealed Jacktropolis ERPing with his 14-year-old ex.
(Content Crasher: Jacktropolis, 0:58)

What really raised their notoriety was their investigation and leaking of the Lewd House Discord server, likely the most infamous SplatSource scandal.
(Lewd House Splanimations Archive article)

They didn’t stop their investigations there, as they were also involved in investigating Ellie Godelia post-Lewd House, with its members archiving both her official apology for and a private call with her related to the Lewd House at the time.
(Ellie Godelia’s Downfall PART 3, 16:58)(Ellie Godelia’s Downfall PART 3, 20:52)

However, it seems like this group suffered the same fate as AntiInkling; fading away as its members lost interest in drama or SplatSource. For example, according to DjSwaggyJ, fellow SDB member Kirin ended up leaving Discord altogether to focus on college, unfortunately deleting some evidence about the Lewd House at the same time.
(A Lesson On Who To Trust, 1:05:29)

As of now, this group seems to be dead. Its associated YouTube channel seems to have been deleted as well, and unfortunately seems to not have been archived, like a lot of drama surrounding the SplatSource community.

THE PROFESSIONALS
The Professionals is a story on how drama groups can go spectacularly wrong. They were a drama group that started with two guys, Jared and EricGaming, which eventually expanded to 5.

Joxic:
This group was founded by Jared and EricGaming, but expanded to 5 members by the time of the disbandment, that being: Jared; Eric; StormySenpai, who’s helped me out with some previous videos and is a real one; 10rayman, being a close friend of Jared and Eric; as well as Lily, who been an amazing friend and supporter for the last few months for both the group as well as myself.

They covered drama with relatively little editing and polish.

Joxic:
Are you willing to sit down and watch a concise video that has a lot of vital info fed to you in a consistent structure, or you wanting to watch a video that hits the length of a movie, with barely any editing, people stumbling, filler, and the evidence is just all over the place. The videos on their own were just really lazily put together and overall, just really hard to watch.

While they did cover some of the bigger stories and were able to get into contact with relatively large names such as ghostoftime1 and Joxic, as the drama ran dry they started targeting “literal-whos,” such as in one video where they covered some random defender of Brian Jackson II.

Joxic:
Like, previously you were discussing about some of the most well-known issues that were a genuine concern to a community, and then you talk about people who aren’t really considered as a threat. I know that Eric called most of the shots when it come to the videos, so good on you for copying the same idea that I did with BJ, but then turn around and talk about a defender of BJ that barely had more than 10 subscribers. By all means, that video was entertaining to do, hearing ghostoftime literally go Super Saiyan, but why you dedicating an entire video on someone who is barely even known or even be considered as a threat?

This group fell apart after their episode on Annalena Schick (then-underage SplatSource artist who intentionally or not drove her ex to suicide after he exposed her for cheating on him), where the Professionals accidentally showed Annalena’s nudes uncensored; when the group was called out for this, Eric reacted quite poorly. After both Jared and Eric made some apologies, the group closed their Discord server and deleted everything on their YouTube channel.
(The_Professionals_Downfall.mp3, 0:40)

Joxic:
Never in my life have I seen someone mess up so… spectacularly, by accidentally sharing CP, uncensored, and never have I seen someone that’s literally illegal to possess be handled and managed so poorly. The video was swiftly taken down, and in all honesty, they probably could have bounced back from it. But if it wasn’t for Eric’s childish behavior after being caught in literal 4K, I sadly wouldn’t have been in this position.

I woke up when this all happened because I’m in a different timezone, and looking back on it all, if I had the same mindset as I have now back then: boo-fucking-hoo Eric, people have the fucking right to be fuming towards you and send their complete dissatisfaction for committing a crime. And to be fair, I’m surprised that you and Jared weren’t punished further, so to say that you “dodged a bullet” is saying something.

And I feel this would be the perfect time to mention that during this recording of that said video, since I was in the second part of the video, he wished that Anna would be (censored), which every single one of us in that recording session showed disapproval of him saying that. I just want to put that out there. However, at the time, I said I would help both of them get through this mentally, and both of them agreed for me to do so.

Both of them shared an apology for their massive mistake that they have caused, which came through “mismanagement.” I don’t know how true that is. The server was shut down a few hours after that incident, and a few days later, the channel was renamed “Disbanded,” and deleted every video that they’ve made.

It doesn’t seem like anything was archived from them, so most of this information is from Joxic’s video talking about the group. In short, a spectacular crash to a subpar drama group.

R6 AND E7
To put it simply, these two were failed drama groups that consisted mostly of kids. To start with R6, they were already known by the other drama reporters/groups as a lame “exposing” group that was more focused on roleplaying as heroes rather than actually doing anything, partially influenced by what they posted on their associated social media accounts.
(Splatsource.comm, 31:39)(Splatsource.comm, 31:43)

They tried to get hackers in their group to “deal with pedos and other bad people.” As shown in some of the Discord screenshots, they had a “secret agent” theme for the group.
(Splatsource.comm, 32:20)(Splatsource.comm, 32:27)

The extent of their “exposing” boiled down to making videos on random people in the community, falsely accusing people and each other with random accusations.
(Splatsource.comm, 32:36)(Splatsource.comm, 32:44)

This group fell apart after a failed raid, with many people leaving or “retiring,” and has likely since disbanded.
(Splatsource.comm, 33:10)(Splatsource.comm, 33:12)

Where does E7 come in? Popping up sometime after R6 started, E7 started as a drama group intended to “take down” R6, but can easily be summed up as “diet R6.” Interestingly, one of the rules was basically “don’t talk trash about E7,” which was enforced a lot and eventually led to infighting.
(Splatsource.comm, 33:05)(Splatsource.comm, 32:58)(Splatsource.comm, 33:08)

While it’s unclear what happened to E7, it likely fell victim to infighting and having its members leave, causing them to disband. Considering what kind of drama goes on in the SplatSource community, maybe it’s for the best that these two groups failed.

Conclusion​
If you’ve come to this OP and there seems to be some drama missing, you’re correct. When I rewrote this OP on April 6, 2026, I removed some of the information I previously covered in the OP to make room for other things I deemed more important/funny. Specifically, I removed information about the following:
  • Some "manipulative" behavior by Ellie Godelia in her section​
  • PizzaHyper​
  • CuteYoshiLover's "apology" Google Doc​
  • Zeldaboy14 grooming allegations
  • LizzieRatcicle's poor VA management, her being pregnant, and her then supposedly being in an abusive household
  • The original conclusion to this OP
  • The sources used only in the above sections
If you want to read about those topics, I moved them into a post in this thread here: https://kiwifarms.st/threads/the-gmod-sfm-splatoon-splatsource-community.216483/post-24161030
With how SplatSource is composed of only the most autistic of Nintendo fans, it was inevitable that the drama surrounding it would become quite crazy, from grooming, gooning, gay-ops, and sex servers. Even though most in SplatSource will probably forget about your drama after a few years, the Internet won’t, and SplatSource proves to be the ultimate lesson in controlling your lust, lest you potentially end up with a DropBox/Google Drive exposing you and your embarrassing ERP forever.

However, the reason people in SplatSource forgive and forget may also be a lesson in why archival is important. Lots of information has been lost to time, and a lot of the work in making this OP was simply just reconstructing what actually happened. You should never take any source for granted; in fact, while I was working on this OP, A Polish Guard wiped his channel of all of his SplatSource drama videos sometime after my post on Jacktropolis in the original thread, leaving me with only the videos that I happened to archive myself. Please, for the sake of people who want to laugh at idiots in this community in the future, archive everything. Alternatively:
DISCORD. NOT EVEN ONCE.
 
Last edited:
Beginning logos:
Splatoon: Garry's Mod Logo/A
Splatoon: Source Flimmaker Logo/A
SplatSource Logo/A
Ellie's video on Brian Jackson II/A
Ellie's Tweets about Brian Jackson II/A
PT4051's Tweets about TZelda/A
Desiree's #EndBrianJackson Tweet/A
Japanese person's Tweets about the Brian Jackson II drama: 1 (A), 2 (A)
CyndaFan's Tweet about TCS and Skylar/A
Ellie's Tweets about #JusticeForTCS/A
TCS's Tweets about the Lewd House/A
Ellie's Tweets about the Lewd House/A
CyndaFan announcing Lewd House reinvestigation/A
Sentinal Simp Coalition expressing suspicion about the reinvestigation/A
TCS's giant apology Tweet/A
Garry Newman confirming the DMCA takedowns were approved by Nintendo/A
Boost's Tweet about Tailasy/A
Proof @CanadaFlagBFDI is TCS: 1 (A), 2 (A), 3 (A)
[Splatoon GMOD Classic] Daily Squid Sisters - 3D Fan Cartoon Animation
Big City Slider Station (Splatoon x Billy Mays) (GMOD)
[Splatoon 3D Cartoon Fan Animation] Splat Territory
[Splatoon 3D Cartoon Fan Animation] Ridiculous Loop of Turf War
SMG4: If Mario Was In... Splatoon (this and above videos locally archived in the Beginning section)
To Catch a Squid - A WARNING about Heavy the Squid / Inspector Heavy (April 7, 2018) / PreserveTube
My True Apology (originally uploaded April 8, 2018, gone now) / Internet Archive
THIS YOUTUBER IS A SEXUAL PREDATOR! - Exposing HeavyTheSquid (originally uploaded May 4th, 2018, YouTube took it down according to comment on Datura’s Ellie Godelia video, reuploaded by Fight-Cruzer 98, A Family Company) / PreserveTube
What happened to Heavy The Squid? (May 5, 2018) / PreserveTube
Heavy the Squid SNEAKS BACK IN?! - The Destruction and Aftermath (May 12, 2018) / PreserveTube
Heavy the Squid - The man who "NEVER" admitted his wrong doings… (June 3, 2018) / PreserveTube
Talk with Texan: Let's talk about Heavy the Squid (June 27, 2018) / PreserveTube
Ellie Godelia's Downfall PART 1 (June 29, 2018, based on Flying Scott’s reaction video, reuploaded by TDF Archived) / PreserveTube
Ellie Godelia's Downfall - REACTION (July 1, 2018) / PreserveTube
Ellie Godelia's Downfall PART 2 (around a month after PART 1, reuploaded by TDF Archived) / PreserveTube
The Truth Stream (originally streamed August 21, 2018), reupload by Datura) / PreserveTube
Mastered Ultra Twils PSA - DISCORD & Twitter Pedophile (September 5, 2018) / PreserveTube
Heavy the Squid video (Unfinished, Possible Wrong Information, Read Description) (made near the end of May according to Datura's Ellie video, uploaded October 14, 2018) / PreserveTube
Ellie Godelia (October 19, 2018) by Datura / PreserveTube
JJGamer’s Downfall (unknown upload date, reuploaded by TDF Archived March 13, 2019) / PreserveTube
Where Are They Now? 1.0 [ARCHIVE] (May 6, 2019) / PreserveTube
[OUTDATED] What Happened To Team Downfall: An Interview With An Ex-Member (June 6, 2019) / PreserveTube
Welcome to the TDF archive channel! (July 2, 2019) / PreserveTube
Brian Jackson Is No More (July 7, 2019) / PreserveTube
Talk with Texan: Let's talk about Brian Jackson II (Drama) (Rantish) (July 7, 2019) / PreserveTube
The Mandatory Brian Jackson II Video (July 12, 2019) / PreserveTube
[OUTDATED] An Open Letter To TehCanadianSpartan (July 13, 2019) / PreserveTube
Ravioli Ravioli Geofcraze634 Squeezed His Hog To A Loli (August 27, 2019) / PreserveTube
Man In Shorts Marina Reaction To [Splatoon GMOD] D.L.O.T.A Episode 2 - Outdoor Wonders By TCS (August 30, 2019) / PreserveTube
TehCanadianSpartan - Going Full Circle (September 14, 2019) / PreserveTube
Skylar Karategirl: Pretension Incarnated (originally uploaded October 11, 2019, now gone) / PreserveTube
Jacktropolis: World's Worst Server Owner (originally uploaded, October 13, 2019, now gone) / PreserveTube
That Time Splatoon YouTubers Were Pr€dators (October 27, 2019) / PreserveTube
The Lewd House Continues: Your Favorite Splat-tubers are Scumbags (originally uploaded November 14, 2019, now gone) / PreserveTube
Why Are Splatoon YouTubers So Bad At Apologizing? (November 24, 2019) / PreserveTube
A Cry For Help (January 27, 2020) / PreserveTube
(Rantish/Expose): Let's Talk About Jacktropolis (January 17, 2020) / PreserveTube
This YouTuber Is Even More Obsessed With TCS Than I Am (January 19, 2020) / PreserveTube
Reacting To Saucy Splatoon Role Plays / PreserveTube
Jacktropolis' Downfall - The Saga Continues (February 13, 2020) / PreserveTube
THE THREE DAY CAMPAIGN RAID (February 16, 2020) / PreserveTube
Statement on Hackings of my Accounts (originally uploaded between Downfall and Content Crasher, reuploaded by JACKTROPOLIS VIDEO ARCHIVE) / PreserveTube
Splatoon Twitter Drama - InkyxKitty (May 19, 2020) / PreserveTube
Content Crasher: Jacktropolis (June 8, 2020) / PreserveTube
My Apology, My return, & My redemption (June 21, 2020) / PreserveTube
TehCanadianSpartan.exe (June 29, 2020) / PreserveTube
Content Crasher: Ellie Godiela (July 16, 2020) / PreserveTube
Ellie Godelia’s Downfall PART 3 (July 17, 2020) / PreserveTube
Splatsource_Dirty_Secret.zip (September 20, 2020) / PreserveTube
Splatoon Twitter Drama - Ellie Godelia, RudyOctolingVA & ThetaRexStudiosVA (November 14, 2020) / PreserveTube
Tailasy exposed video (December 8, 2020) / PreserveTube
Tailasy exposed Part 2 (December 11, 2020) / PreserveTube
My Important Speech announcement. (March 16, 2021) / PreserveTube
SplatSource Cop - Ellie Godelia (March 19, 2021) / PreserveTube
Brian_Jackson.exe (March 21, 2021) / PreserveTube
Brian's_Resonse.mp3 (March 24, 2021) / PreserveTube
The_Professionals_Downfall.mp3 (July 14, 2021) / PreserveTube
To Catch a Squidette - A WARNING about Ellie Godelia / Savannah Moscalla (September 8, 2021) / locally archived in the Post Lewd House section
Splatsource.comm (September 27, 2021) / PreserveTube
Welcome to the Jacktropolis YouTube Channel! (unknown upload date, reuploaded by JACKTROPOLIS VIDEO ARCHIVE November 14, 2021) / PreserveTube
The "REAL" Issue with SFM/Gmod Community (March 27, 2022) / PreserveTube
A Lesson On Who To Trust - 225 At Nite Episode 14 (Originally streamed March 27, 2023) / PreserveTube
An Excavation Of The Largest Scandal in Splatsource History - 225 At Nite Episode 15 (Originally streamed April 3, 2023) / PreserveTube
A Conversation With Ellie Godelia - 225 At Nite Episode 16 (Originally streamed April 10, 2023) / PreserveTube
My reupload of Unfinished Business - 225 At Nite Episode 26 (Originally uploaded June 28, 2023), locally archived in the Zengo OP
TehCanadianSpartan (TCS) STILL CONTINUES TO BE MORE WORST (March 20, 2024) / PreserveTube
My reupload of Bman78 Interrogation (Originally uploaded April 30, 2025) / PreserveTube of original

(Reserved)
 
Last edited:
Amazing work.

A possible cow to consider adding in would be emoboyfucker69 / Splatinist / bannanahshu due to her proximity to these retards. She's infamous in the main Splatoon community due to sockpuppeting to harass various artists with threats of getting them suspended.
I'm going through the archive of her Tweets during this time and getting info related to this community, thanks for the heads-up!

Splatoon is honestly my favorite game series, but the cOmMuNitY are absolute cretins.
The funny part (and I wasn't sure how to include this in the OP) is that there are a not-insignificant amount of SplatSource people who specifically came from SMG4 and/or don't know anything about the game. One of the characters SMG4 introduced (around a week before Splatoon 2's release) was an Inkling girl named Meggy Spletzer, which a lot of people loved. Of course, many of these SMG4 fans were not Splatoon fans (or at least not initially) but joined the SplatSource community because they liked the Inkling girl Meggy and wanted to make GMOD/SFM fanart with her in it, leading to them using the Inklings/Octolings as sort of dolls. In fact, Geofcraze634 used to be in SMG4's videos a long time ago, when they were both SM64 machinima makers and not using GMOD.

There's this video by a competitive Splatoon player who talks (in a quite over-the-top way) about SplatSource people not knowing anything about Splatoon and was friends with Brian Jackson II when he was around; apparently Brian Jackson II didn't even know what Rainmaker (one of the main competitive modes) was and thought it was an RPG mode :story:
PreserveTube

Is that Gonta from DRV3? Funny, this is the second dangansperg that's also into splatsource that I've learned about on here
Yep, and there are some more Danganronpa (or general anime/Japanese media fans) in this community. Here's mango3st's post of his brother, represented by the red Inkling, smacking Junko Enoshima with a Bible. This was apparently requested by said brother.
1743988183702.png1743988603021.png
L/A
 
Yep, and there are some more Danganronpa (or general anime/Japanese media fans) in this community. Here's mango3st's post of his brother, represented by the red Inkling, smacking Junko Enoshima with a Bible. This was apparently requested by said brother.
1743988183702.png1743988603021.png
Based. Should have smacked Toko as well while he was at it. That girl is basically the pinnacle of a BP lolcow
 
I was wondering how you were going to use nine reserve spots without padding the fuck out of the OP, but somehow you managed to make an amazing thread. Bravo. Reading about random glupshitto internet drama from autists is seriously underrated.

Amazing work.

A possible cow to consider adding in would be emoboyfucker69 / Splatinist / bannanahshu due to her proximity to these retards. She's infamous in the main Splatoon community due to sockpuppeting to harass various artists with threats of getting them suspended.
The fact that you tried to shoehorn in Tiffany and not TAILASY is almost criminal. More people deserve to know about Tailasy.
 
I was wondering how you were going to use nine reserve spots without padding the fuck out of the OP, but somehow you managed to make an amazing thread. Bravo. Reading about random glupshitto internet drama from autists is seriously underrated.
Thank you, in fact I had only meant to use 6 reserve spots but the TCS and the Lewd House ended up being too large for one post and the Lewd House Part 2 spoiler + "General Drama" section + the conclusion was too large for one post, so I had to add a few extra (Reserved) posts. To be honest I was a little worried it would look like the recent UTTP thread until I realized I could spoiler everything (also helps with scrolling).

I guess since it's opportune, here is the word count of the "final draft" before I uploaded it all to Kiwi Farms:
word count.png
I've heard many things about the exact character limit in a post (the error says "less than 64,000" and I've heard 50,000 around on the Farms) but testing it myself in DMs, the character limit seems to be 62775 (for this, it would mean a little over 5 posts are needed, so OP + 5 reserved posts + extra just in case). Speaking of character limits, I had issues inserting some attachments in the Lewd House 1 spoiler because the BBcode for an attachment kept making the post go over the character limit until I shortened some paragraphs :stress:

The fact that you tried to shoehorn in Tiffany and not TAILASY is almost criminal. More people deserve to know about Tailasy.
I really want to write about him, and what I've found so far is really horrifying (and more importantly, really funny) but I'm not sure how to put him in with the way I've set things up so far. From what I've found, he doesn't seem to be a Splatoon GMOD/SFM dude, but a regular Splatoon fan, and not only is a lot of the stuff about him seemingly deleted / lost to time, I'm having trouble finding stuff about him regarding his interactions with SplatSource people. I'm attempting to limit this thread to specifically SplatSource, as a Splatoon general community watch thread is outside of my ability.

Maybe I could put a section for "drama hunters," since it would include Zoey and Tailasy, but it also starts to be less SplatSource and more "Splatoon X/Twitter" so I'm a little hesitant to start working on something like that.
 
Last edited:
I've found, he doesn't seem to be a Splatoon GMOD/SFM dude
Oh he 100% was, he was an avid SMG4 fan (iirc he wanted to fuck meggy? Whatever the splatoon character they had was called) and a lot of people he got into drama with were also SMG4 fans. That was also 3-5 years ago, and a lot of the Xitter slapfights have been deleted. He seems to mostly sperg about anime nowadays though sadly.
 
Back
Top Bottom